Os08t0345500-00

Locus

Os08g0345500

Description

Similar to Cellulose synthase-like protein D3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLD3

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE D3

Oryzabase Gene Symbol Synonym(s)

OsCSLD3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK375198 (DDBJ)

Protein Evidence

Q7EZW6 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Expression Databases

TENOR (Os08t0345500-00)

Others

Oryzabase (9014)

Transcript

3446 bp

>Os08t0345500-00 Similar to Cellulose synthase-like protein D3.
GAGCGATGTCGACGGGGCCGGGGAAGAAGGCGATCCGGAACGCCGGCGGTGTCGGCGGCG
GCGCCGGGCCGTCGGCGGGCGGGCCGCGCGGGCCGGCGGGGCAGGCGGTGAAGTTCGCGC
GGCGGACGTCGAGCGGGCGGTACGTGAGCCTGTCGCGGGAGGACATCGACATGGAGGGCG
AGCTGGCGGCGGACtacaccaactacacggtgcagatcccgccgacgcccgacaaccagc
cgatgctgaacggcgcggagccggcgtcggtggcgatgaaggccgaggagcagtacgtgt
ccaactccctcttcaccggcggcttcaacagcgccacccgcgcccacctcatggacaagg
tcatcgagtcgtcggtctcccacccgcagatggccggcgccaaggggtcgcgctgcgcca
tgcccgcctgcgacggcagcgccatgcgcaacgagcgcggcgaggacgtcgacccctgcg
agtgccacttcaagatctgccgcgactgctacctcgacgcccagaaggacggctgcatct
gccccggatgcaaggagcactacaagatcggcgagtacgccgacgatgacccgcacgacg
gcaagctccacctgccgggccccggcggcggcggcaacaagtcgctgctggcgcgcaacc
agaacggcgagttcgaccacaaccggtggctcttcgagagctccggcacctacggctacg
gcaacgcgttctggcccaagggcggcatgtacgacgacgacctggacgacgacgtcgaca
agcttggcggcgacggcggcggcggcggcggcggcgggccgctccccgagcagaagccgt
tcaagccgctgacgcgcaagatcccgatgccgacgtcggtgatcagcccgtaccggATCT
tcatcgtgatccggatgttcgtgctcctcttctacctcacgtggcgcatccgcaacccaa
acatggaggcgctctggctgtgggggatgtccatcgtctgcgagctctggttcgccttct
catggctgctcgacatgctccccaaggtgaacccggtcaaccggagcaccgacctagccg
tgctcaaggagaagttcgagacgccgtcgccgtccaacccgcacggccgctccgacctcc
cgggcctcgacgtgttcgtctccaccgccgacccggagaaggagccggtgctcaccacgg
cgaccaccatcctctccatcctcgccgtggactaccccgtcgagaagctcgcctgctacg
tgtccgacgacggcggcgcgctgctcacctttgaggccatggcggaggcggcgagcttcg
ccaacgtgtgggtgcccttctgcaagaagcacgacatcgagccccgcaacccggacagct
acttcagcgtcaagggcgacccgacgaagggcaagcggcgcaacgacttcgtcaaggacc
ggcgcagggtgaagcgcgagttcgacgagttcaaggtgcgcatcaatggcctcccggact
ccatccggcggcgctccgacgcgttcaacgcgcgcgaggacatgaagatgctcaagcacc
tccgcgagacgggtgccgacccgtcggagcagcccaaggtgaagaaggcgacgtggatgg
cggacggctcgcactggccggggacatgggcggcgtcggcgcccgaccacgccaagggca
accacgccgggatcctccaggtgatgctcaagccgccgtcgcccgacccgctctacggga
tgcacgacgacgaccagatgatcgacttcagcgacgtcgacatccgcctcccgatgctcg
tctacatgtcgcgggagaagcgcccgggctacgaccacaacaagaaggccggcgccatga
acgcgctcgtccgatgctccgccgtcatgtcgaacggccccttcatgctcaacttcgact
gcgaccactacatcaacaacgcgcaggcggtgcgcgaggccatgtgcttcttcatggacc
gcggcggcgagcgcatcgcctacatccagttcccgcagcgcttcgaggggatcgacccct
ccgaccgctacgccaacaacaacaccgtcttcttcgatggcaacatgcgcgcgctcgacg
gcctccagggccccatgtacgtcggcacgggctgcatgttccgccgcttcgccgtctacg
gcttcgacccgccgcgcaccgccgagtacacggggtggctcttcaccaagaagaaggtga
ccacgttcaaggacccggagtcggacacccagacgctcaaggcggaggacttcgacgccg
agctcacgtcgcacctcgtcccgcgccggttcggcaactcgtcgccgttcatggcgtcga
tccccgtcgccgagttccaggcgcggcccctcgccgaccacccggcggtgctgcacggca
ggccgtccggcgcgctcaccgtgccgcggccgccgctggacccgccgacggtggcggagg
ccgtgtcggtgatctcgtgctggtacgaggacaagacggagtggggcgaccgcgtggggt
ggatctacggctccgtcaccgaggacgtggtgaccggctaccggatgcacaaccgcgggt
ggcgctccgtctactgcatcaccaagcgcgacgcgttcctgggcacggcgccgatcaacc
tcaccgacaggctccaccaggtgctccggtgggcgacgggctccgtcgagatcttcttct
cccggaacaacgcgttcctggcgtcgcgcaagctcatgctgctgcagcggatctcctacc
tcaacgtcggcatctaccccttcacctccatcttcctcctcgtctactgcttcatcccgg
cgctctccctcttctccggcttcttcatcgtccagaagctcgacatcgccttcctttgct
acctcctcaccatgaccatcaccctcgtcgccctcggcatcctcgaggtcaagtggtccg
gcatcgagctcgaggattggtggcgcaacgagcaattctggctcatagggacgagcgcgc
acctgtacgcggtggtgcaggggttgctgaaggtgatggccgggatagagatctccttca
cgctgacggcgaaggcggcggcggacgacaacgaggacatctacgcggacctctacatcg
tcaagtggtcgtcgctgctgatcccgcccatcaccatcgggatggtgaacatcatcgcca
tcgccttcgccttcgcgaggaccatctacagcgacaacccgcggtgggggaagttcatcg
gcggcggcttcttcagcttctgggtgctcgcccacctcaaccccttcgccaagggcctca
tggggcggcgcggcaagacgcccaccatcgtcttcgtctggtcgggcctcctctcaatca
ccgtctccctgctctgggtcgccatcagcccgccGGAGGCCAACTCCAACGGCGGCGCGC
GCGGCGGCGGCTTCCAGTTCCCTTGA

CDS

3441 bp

>Os08t0345500-00 Similar to Cellulose synthase-like protein D3.
ATGTCGACGGGGCCGGGGAAGAAGGCGATCCGGAACGCCGGCGGTGTCGGCGGCGGCGCC
GGGCCGTCGGCGGGCGGGCCGCGCGGGCCGGCGGGGCAGGCGGTGAAGTTCGCGCGGCGG
ACGTCGAGCGGGCGGTACGTGAGCCTGTCGCGGGAGGACATCGACATGGAGGGCGAGCTG
GCGGCGGACtacaccaactacacggtgcagatcccgccgacgcccgacaaccagccgatg
ctgaacggcgcggagccggcgtcggtggcgatgaaggccgaggagcagtacgtgtccaac
tccctcttcaccggcggcttcaacagcgccacccgcgcccacctcatggacaaggtcatc
gagtcgtcggtctcccacccgcagatggccggcgccaaggggtcgcgctgcgccatgccc
gcctgcgacggcagcgccatgcgcaacgagcgcggcgaggacgtcgacccctgcgagtgc
cacttcaagatctgccgcgactgctacctcgacgcccagaaggacggctgcatctgcccc
ggatgcaaggagcactacaagatcggcgagtacgccgacgatgacccgcacgacggcaag
ctccacctgccgggccccggcggcggcggcaacaagtcgctgctggcgcgcaaccagaac
ggcgagttcgaccacaaccggtggctcttcgagagctccggcacctacggctacggcaac
gcgttctggcccaagggcggcatgtacgacgacgacctggacgacgacgtcgacaagctt
ggcggcgacggcggcggcggcggcggcggcgggccgctccccgagcagaagccgttcaag
ccgctgacgcgcaagatcccgatgccgacgtcggtgatcagcccgtaccggATCTtcatc
gtgatccggatgttcgtgctcctcttctacctcacgtggcgcatccgcaacccaaacatg
gaggcgctctggctgtgggggatgtccatcgtctgcgagctctggttcgccttctcatgg
ctgctcgacatgctccccaaggtgaacccggtcaaccggagcaccgacctagccgtgctc
aaggagaagttcgagacgccgtcgccgtccaacccgcacggccgctccgacctcccgggc
ctcgacgtgttcgtctccaccgccgacccggagaaggagccggtgctcaccacggcgacc
accatcctctccatcctcgccgtggactaccccgtcgagaagctcgcctgctacgtgtcc
gacgacggcggcgcgctgctcacctttgaggccatggcggaggcggcgagcttcgccaac
gtgtgggtgcccttctgcaagaagcacgacatcgagccccgcaacccggacagctacttc
agcgtcaagggcgacccgacgaagggcaagcggcgcaacgacttcgtcaaggaccggcgc
agggtgaagcgcgagttcgacgagttcaaggtgcgcatcaatggcctcccggactccatc
cggcggcgctccgacgcgttcaacgcgcgcgaggacatgaagatgctcaagcacctccgc
gagacgggtgccgacccgtcggagcagcccaaggtgaagaaggcgacgtggatggcggac
ggctcgcactggccggggacatgggcggcgtcggcgcccgaccacgccaagggcaaccac
gccgggatcctccaggtgatgctcaagccgccgtcgcccgacccgctctacgggatgcac
gacgacgaccagatgatcgacttcagcgacgtcgacatccgcctcccgatgctcgtctac
atgtcgcgggagaagcgcccgggctacgaccacaacaagaaggccggcgccatgaacgcg
ctcgtccgatgctccgccgtcatgtcgaacggccccttcatgctcaacttcgactgcgac
cactacatcaacaacgcgcaggcggtgcgcgaggccatgtgcttcttcatggaccgcggc
ggcgagcgcatcgcctacatccagttcccgcagcgcttcgaggggatcgacccctccgac
cgctacgccaacaacaacaccgtcttcttcgatggcaacatgcgcgcgctcgacggcctc
cagggccccatgtacgtcggcacgggctgcatgttccgccgcttcgccgtctacggcttc
gacccgccgcgcaccgccgagtacacggggtggctcttcaccaagaagaaggtgaccacg
ttcaaggacccggagtcggacacccagacgctcaaggcggaggacttcgacgccgagctc
acgtcgcacctcgtcccgcgccggttcggcaactcgtcgccgttcatggcgtcgatcccc
gtcgccgagttccaggcgcggcccctcgccgaccacccggcggtgctgcacggcaggccg
tccggcgcgctcaccgtgccgcggccgccgctggacccgccgacggtggcggaggccgtg
tcggtgatctcgtgctggtacgaggacaagacggagtggggcgaccgcgtggggtggatc
tacggctccgtcaccgaggacgtggtgaccggctaccggatgcacaaccgcgggtggcgc
tccgtctactgcatcaccaagcgcgacgcgttcctgggcacggcgccgatcaacctcacc
gacaggctccaccaggtgctccggtgggcgacgggctccgtcgagatcttcttctcccgg
aacaacgcgttcctggcgtcgcgcaagctcatgctgctgcagcggatctcctacctcaac
gtcggcatctaccccttcacctccatcttcctcctcgtctactgcttcatcccggcgctc
tccctcttctccggcttcttcatcgtccagaagctcgacatcgccttcctttgctacctc
ctcaccatgaccatcaccctcgtcgccctcggcatcctcgaggtcaagtggtccggcatc
gagctcgaggattggtggcgcaacgagcaattctggctcatagggacgagcgcgcacctg
tacgcggtggtgcaggggttgctgaaggtgatggccgggatagagatctccttcacgctg
acggcgaaggcggcggcggacgacaacgaggacatctacgcggacctctacatcgtcaag
tggtcgtcgctgctgatcccgcccatcaccatcgggatggtgaacatcatcgccatcgcc
ttcgccttcgcgaggaccatctacagcgacaacccgcggtgggggaagttcatcggcggc
ggcttcttcagcttctgggtgctcgcccacctcaaccccttcgccaagggcctcatgggg
cggcgcggcaagacgcccaccatcgtcttcgtctggtcgggcctcctctcaatcaccgtc
tccctgctctgggtcgccatcagcccgccGGAGGCCAACTCCAACGGCGGCGCGCGCGGC
GGCGGCTTCCAGTTCCCTTGA

Protein

1147 aa

>Os08t0345500-00 Similar to Cellulose synthase-like protein D3.
MSTGPGKKAIRNAGGVGGGAGPSAGGPRGPAGQAVKFARRTSSGRYVSLSREDIDMEGEL
AADYTNYTVQIPPTPDNQPMLNGAEPASVAMKAEEQYVSNSLFTGGFNSATRAHLMDKVI
ESSVSHPQMAGAKGSRCAMPACDGSAMRNERGEDVDPCECHFKICRDCYLDAQKDGCICP
GCKEHYKIGEYADDDPHDGKLHLPGPGGGGNKSLLARNQNGEFDHNRWLFESSGTYGYGN
AFWPKGGMYDDDLDDDVDKLGGDGGGGGGGGPLPEQKPFKPLTRKIPMPTSVISPYRIFI
VIRMFVLLFYLTWRIRNPNMEALWLWGMSIVCELWFAFSWLLDMLPKVNPVNRSTDLAVL
KEKFETPSPSNPHGRSDLPGLDVFVSTADPEKEPVLTTATTILSILAVDYPVEKLACYVS
DDGGALLTFEAMAEAASFANVWVPFCKKHDIEPRNPDSYFSVKGDPTKGKRRNDFVKDRR
RVKREFDEFKVRINGLPDSIRRRSDAFNAREDMKMLKHLRETGADPSEQPKVKKATWMAD
GSHWPGTWAASAPDHAKGNHAGILQVMLKPPSPDPLYGMHDDDQMIDFSDVDIRLPMLVY
MSREKRPGYDHNKKAGAMNALVRCSAVMSNGPFMLNFDCDHYINNAQAVREAMCFFMDRG
GERIAYIQFPQRFEGIDPSDRYANNNTVFFDGNMRALDGLQGPMYVGTGCMFRRFAVYGF
DPPRTAEYTGWLFTKKKVTTFKDPESDTQTLKAEDFDAELTSHLVPRRFGNSSPFMASIP
VAEFQARPLADHPAVLHGRPSGALTVPRPPLDPPTVAEAVSVISCWYEDKTEWGDRVGWI
YGSVTEDVVTGYRMHNRGWRSVYCITKRDAFLGTAPINLTDRLHQVLRWATGSVEIFFSR
NNAFLASRKLMLLQRISYLNVGIYPFTSIFLLVYCFIPALSLFSGFFIVQKLDIAFLCYL
LTMTITLVALGILEVKWSGIELEDWWRNEQFWLIGTSAHLYAVVQGLLKVMAGIEISFTL
TAKAAADDNEDIYADLYIVKWSSLLIPPITIGMVNIIAIAFAFARTIYSDNPRWGKFIGG
GFFSFWVLAHLNPFAKGLMGRRGKTPTIVFVWSGLLSITVSLLWVAISPPEANSNGGARG
GGFQFP*

5'UTR

chr08:15645941..15645945 (- strand) : 5 bp

CDS

chr08:15642960..15645940 (- strand) : 2981 bp

chr08:15642407..15642866 (- strand) : 460 bp

FASTA

>Os08t0345500-00 class=Sequence position=chr08:15642407..15645945 (- strand)
GAGCGATGTC GACGGGGCCG GGGAAGAAGG CGATCCGGAA CGCCGGCGGT GTCGGCGGCG GCGCCGGGCC GTCGGCGGGC
GGGCCGCGCG GGCCGGCGGG GCAGGCGGTG AAGTTCGCGC GGCGGACGTC GAGCGGGCGG TACGTGAGCC TGTCGCGGGA
GGACATCGAC ATGGAGGGCG AGCTGGCGGC GGACtacacc aactacacgg tgcagatccc gccgacgccc gacaaccagc
cgatgctgaa cggcgcggag ccggcgtcgg tggcgatgaa ggccgaggag cagtacgtgt ccaactccct cttcaccggc
ggcttcaaca gcgccacccg cgcccacctc atggacaagg tcatcgagtc gtcggtctcc cacccgcaga tggccggcgc
caaggggtcg cgctgcgcca tgcccgcctg cgacggcagc gccatgcgca acgagcgcgg cgaggacgtc gacccctgcg
agtgccactt caagatctgc cgcgactgct acctcgacgc ccagaaggac ggctgcatct gccccggatg caaggagcac
tacaagatcg gcgagtacgc cgacgatgac ccgcacgacg gcaagctcca cctgccgggc cccggcggcg gcggcaacaa
gtcgctgctg gcgcgcaacc agaacggcga gttcgaccac aaccggtggc tcttcgagag ctccggcacc tacggctacg
gcaacgcgtt ctggcccaag ggcggcatgt acgacgacga cctggacgac gacgtcgaca agcttggcgg cgacggcggc
ggcggcggcg gcggcgggcc gctccccgag cagaagccgt tcaagccgct gacgcgcaag atcccgatgc cgacgtcggt
gatcagcccg taccggATCT tcatcgtgat ccggatgttc gtgctcctct tctacctcac gtggcgcatc cgcaacccaa
acatggaggc gctctggctg tgggggatgt ccatcgtctg cgagctctgg ttcgccttct catggctgct cgacatgctc
cccaaggtga acccggtcaa ccggagcacc gacctagccg tgctcaagga gaagttcgag acgccgtcgc cgtccaaccc
gcacggccgc tccgacctcc cgggcctcga cgtgttcgtc tccaccgccg acccggagaa ggagccggtg ctcaccacgg
cgaccaccat cctctccatc ctcgccgtgg actaccccgt cgagaagctc gcctgctacg tgtccgacga cggcggcgcg
ctgctcacct ttgaggccat ggcggaggcg gcgagcttcg ccaacgtgtg ggtgcccttc tgcaagaagc acgacatcga
gccccgcaac ccggacagct acttcagcgt caagggcgac ccgacgaagg gcaagcggcg caacgacttc gtcaaggacc
ggcgcagggt gaagcgcgag ttcgacgagt tcaaggtgcg catcaatggc ctcccggact ccatccggcg gcgctccgac
gcgttcaacg cgcgcgagga catgaagatg ctcaagcacc tccgcgagac gggtgccgac ccgtcggagc agcccaaggt
gaagaaggcg acgtggatgg cggacggctc gcactggccg gggacatggg cggcgtcggc gcccgaccac gccaagggca
accacgccgg gatcctccag gtgatgctca agccgccgtc gcccgacccg ctctacggga tgcacgacga cgaccagatg
atcgacttca gcgacgtcga catccgcctc ccgatgctcg tctacatgtc gcgggagaag cgcccgggct acgaccacaa
caagaaggcc ggcgccatga acgcgctcgt ccgatgctcc gccgtcatgt cgaacggccc cttcatgctc aacttcgact
gcgaccacta catcaacaac gcgcaggcgg tgcgcgaggc catgtgcttc ttcatggacc gcggcggcga gcgcatcgcc
tacatccagt tcccgcagcg cttcgagggg atcgacccct ccgaccgcta cgccaacaac aacaccgtct tcttcgatgg
caacatgcgc gcgctcgacg gcctccaggg ccccatgtac gtcggcacgg gctgcatgtt ccgccgcttc gccgtctacg
gcttcgaccc gccgcgcacc gccgagtaca cggggtggct cttcaccaag aagaaggtga ccacgttcaa ggacccggag
tcggacaccc agacgctcaa ggcggaggac ttcgacgccg agctcacgtc gcacctcgtc ccgcgccggt tcggcaactc
gtcgccgttc atggcgtcga tccccgtcgc cgagttccag gcgcggcccc tcgccgacca cccggcggtg ctgcacggca
ggccgtccgg cgcgctcacc gtgccgcggc cgccgctgga cccgccgacg gtggcggagg ccgtgtcggt gatctcgtgc
tggtacgagg acaagacgga gtggggcgac cgcgtggggt ggatctacgg ctccgtcacc gaggacgtgg tgaccggcta
ccggatgcac aaccgcgggt ggcgctccgt ctactgcatc accaagcgcg acgcgttcct gggcacggcg ccgatcaacc
tcaccgacag gctccaccag gtgctccggt gggcgacggg ctccgtcgag atcttcttct cccggaacaa cgcgttcctg
gcgtcgcgca agctcatgct gctgcagcgg atctcctacc tcaacgtcgg catctacccc ttcacctcca tcttcctcct
cgtctactgc ttcatcccgg cgctctccct cttctccggc ttcttcatcg tccagaagct cgacatcgcc ttcctttgct
acctcctcac catgaccatc accctcgtcg ccctcggcat cctcgaggtc aagtggtccg gcatcgagct cgaggattgg
tggcgcaacg agcaattctg gctcatctca ggcacaaaac acacacatat acacctccat tctcttcctt cctcacacga
tgatcaccgc cattgatgac gtcatcattg atgattcgca gggacgagcg cgcacctgta cgcggtggtg caggggttgc
tgaaggtgat ggccgggata gagatctcct tcacgctgac ggcgaaggcg gcggcggacg acaacgagga catctacgcg
gacctctaca tcgtcaagtg gtcgtcgctg ctgatcccgc ccatcaccat cgggatggtg aacatcatcg ccatcgcctt
cgccttcgcg aggaccatct acagcgacaa cccgcggtgg gggaagttca tcggcggcgg cttcttcagc ttctgggtgc
tcgcccacct caaccccttc gccaagggcc tcatggggcg gcgcggcaag acgcccacca tcgtcttcgt ctggtcgggc
ctcctctcaa tcaccgtctc cctgctctgg gtcgccatca gcccgccGGA GGCCAACTCC AACGGCGGCG CGCGCGGCGG
CGGCTTCCAG TTCCCTTGA

Locus: Os08g0345500

Loading...

Locus: Os08g0345500

Loading...