Os08t0369700-01

Locus

Os08g0369700

Description

FeS cluster insertion domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ISC10

CGSNL Gene Name

IRON-SULFUR CLUSTER PROTEIN 10

Oryzabase Gene Symbol Synonym(s)

OsISC10

Oryzabase Gene Name Synonym(s)

Iron-sulfur cluster protein 10

Transcript Evidence

AK287500 (DDBJ, Best hit)

Protein Evidence

NP_001148399.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: iron-sulfur cluster assembly (GO:0016226)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Functional domain (InterPro)

FeS cluster biogenesis (IPR000361)

FeS cluster insertion (IPR016092)

Full-length cDNA

J043034C21 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0369700-01)

Others

Oryzabase (13425)

KEGG (Os08t0369700-01)

Transcript

951 bp

>Os08t0369700-01 FeS cluster insertion domain containing protein.
AGACTGCGCCTAAAGCATTTTCCCAGACTCTCTCACACCGAAACGTAGAGAAACTCGCGA
GTTGGCCCCACGTGTCATCCTCACGACCGTGTCCAACCCAGGGACCCAAACCGACCGACC
TCCCACCACATCCCCCGTTCCGCCGCCTCCGCTTCCGCATCGCGCCGCCCCGGCCACGAC
CTTCTCCCGCCGTCCTGGAACCGGGCGATGGCCGCGTCGTCGTCGTCGTCCCGTCCCCTG
CTCCGCCGCGTCGCGGCCCTCCTCGGCGGCCGCGTGCGCGCCAGCCACCGCCTTCTCTCC
TCCTCGCCGTCCTCCTCCTCCGCCGCCGCCGCAGCAACCGAGAGGGCGTCGCCGCCGTCG
CCCGCAGACCCGGATACCGTGCACATGACGGATGGCTGCATCCGAAGATTAAAAGAATTA
CATGCTAAAGAACCACCTTCTGAAGGTAAGATGCTGCGATTAAGTGTTGAAGCTGGTGGA
TGTTCTGGATTCCAATATTCTTTCTCTCTTGATGACAAGAAAAACTCAGATGATCGGATC
TTTGAGAAAGAAGGTGTTAAATTGGTTGTGGACGATGTCTCATATGACTTTGTGAAAGGT
GCCACTGTGGATTATGAGGAAGAACTTATACGCTCCGCATTCGTGGTATCAACAAATCCT
AGTGCAGTTGGGGGCTGCAGTTGCAAGAGTTCTTTTATGGTCAATTAGTTTCAGCTTTAG
TAGCTTGATGAGATAGGTAATATGTGATAGCATTCTGTATTGAAATATACTTCATTGATA
CATGTGTACAATTTGGTATATTTGGTGGTTCCAAAGATGTTATTTCTACTGCTTCTACCT
TGTGATCCTTGTGATTACAAGTTATGTATACTGAATCATTTGGCCTTCAGTATTTATTTG
TATGTTGCTTCTTTCAAAGTGCTAAATAAGATGCAATCTTTTGTAACATTG

CDS

501 bp

>Os08t0369700-01 FeS cluster insertion domain containing protein.
ATGGCCGCGTCGTCGTCGTCGTCCCGTCCCCTGCTCCGCCGCGTCGCGGCCCTCCTCGGC
GGCCGCGTGCGCGCCAGCCACCGCCTTCTCTCCTCCTCGCCGTCCTCCTCCTCCGCCGCC
GCCGCAGCAACCGAGAGGGCGTCGCCGCCGTCGCCCGCAGACCCGGATACCGTGCACATG
ACGGATGGCTGCATCCGAAGATTAAAAGAATTACATGCTAAAGAACCACCTTCTGAAGGT
AAGATGCTGCGATTAAGTGTTGAAGCTGGTGGATGTTCTGGATTCCAATATTCTTTCTCT
CTTGATGACAAGAAAAACTCAGATGATCGGATCTTTGAGAAAGAAGGTGTTAAATTGGTT
GTGGACGATGTCTCATATGACTTTGTGAAAGGTGCCACTGTGGATTATGAGGAAGAACTT
ATACGCTCCGCATTCGTGGTATCAACAAATCCTAGTGCAGTTGGGGGCTGCAGTTGCAAG
AGTTCTTTTATGGTCAATTAG

Protein

167 aa

>Os08t0369700-01 FeS cluster insertion domain containing protein.
MAASSSSSRPLLRRVAALLGGRVRASHRLLSSSPSSSSAAAAATERASPPSPADPDTVHM
TDGCIRRLKELHAKEPPSEGKMLRLSVEAGGCSGFQYSFSLDDKKNSDDRIFEKEGVKLV
VDDVSYDFVKGATVDYEEELIRSAFVVSTNPSAVGGCSCKSSFMVN*

5'UTR

chr08:17225171..17225377 (+ strand) : 207 bp

CDS

chr08:17225378..17225575 (+ strand) : 198 bp

chr08:17226837..17226967 (+ strand) : 131 bp

chr08:17227150..17227258 (+ strand) : 109 bp

chr08:17227728..17227790 (+ strand) : 63 bp

3'UTR

chr08:17227791..17228033 (+ strand) : 243 bp

FASTA

>Os08t0369700-01 class=Sequence position=chr08:17225171..17228033 (+ strand)
AGACTGCGCC TAAAGCATTT TCCCAGACTC TCTCACACCG AAACGTAGAG AAACTCGCGA GTTGGCCCCA CGTGTCATCC
TCACGACCGT GTCCAACCCA GGGACCCAAA CCGACCGACC TCCCACCACA TCCCCCGTTC CGCCGCCTCC GCTTCCGCAT
CGCGCCGCCC CGGCCACGAC CTTCTCCCGC CGTCCTGGAA CCGGGCGATG GCCGCGTCGT CGTCGTCGTC CCGTCCCCTG
CTCCGCCGCG TCGCGGCCCT CCTCGGCGGC CGCGTGCGCG CCAGCCACCG CCTTCTCTCC TCCTCGCCGT CCTCCTCCTC
CGCCGCCGCC GCAGCAACCG AGAGGGCGTC GCCGCCGTCG CCCGCAGACC CGGATACCGT GCACATGACG GATGGCTGCA
TCCGAGTAGG TCCCCGTACC CTCCTCCCTC CCTTCGTTCA TTCCCTCAGC AAGATCGTGT CTCCCGTATT CTGTGTGGAA
TATAGGCATA ATAGGAGGTT TCTGCTGAAA ACTTTTGGTA ACATGATGTT TTCTGTTTGA TTTGGTAAGA TTTGATTTAG
GTAATCTGTC GTGATGTTCT GGGAAAATAT GCGGCCTCCC TCTTGAGGTT TTTTTGGGCT TTGCACTGAC AAAATACCGA
TATAGCGAAT TGAATTCGGA GTCAGCTAGT CACCGTGTGC TATGTTAATC TGCTTTGGAA ATGCTACAAC TGGAAGCACA
TTTTCTGAAC ATTTTCACTA GTTCAGTAAG GGGGCAAAAT GCAAAAGCCT GCATGAGAAT TCGTTTGGGT ATGACAGCCA
CAAAAAATGG GTGTTGGATT GCTTTTTTTT TTCTTTTTCT AAATGGAAGT TTATGTTGGA AGCTGTGAAG TGTAGGACAA
CTACAAGCAA TGAAGCATAA TAAGTTGTTC CAAAGCTCAG AGTGAAAAAC TAAAAACACT ATTAGACAGC CGAAACATAA
TCTTGTCAGC ACTTTGATAT TTAAGTTATT GCTACATTAT ATTTGGAGCA TGCACACACC TTCATTTCGC GTTCCCGTAA
ATAATAGAGT GGCAATAGAA GGCTTTGACG CCCTTCATTT GATTGCGCCA GAGCTAAATG CTGTGTTGAT TATACAAGTT
TGTTTGGTCA CCTAGCCTTG CCTATATTTC TCACTGTTGA AATGGAGTAT TCTTTTTGGG CTATATCAGG GTTTCTGTGA
CAGGATTTCA ATTCTTGTTA CATGTGTTCA GGGTCTCTAG ATGAATGCAT TTTCTGTTGT TAATACTAGA CAGTAAAAGT
GGTTTCATAT GCTTACACTT ATACCCCATA TGTTTGCAAA ACCTTTAAAA TATTATGAAA ATTTTGAAAT ATGGACATTG
CTAAAGGGAT TTCCTGAAAT TTCATCAGAG GTGATATATT TTTTTTTGGA AACAACAAAT ATTTCCTGCT TTTTTTTTGT
TTTTGTCTTT GATTCATTTT CAACTGTTAC ATTTGAATAT GCTACTTCTA TCACATTTTG TTCAACGCAG TAGGAACATT
TGAGAATTCA ATTTGTGCCA AGTTGACTTC AAATATGCTT TTGGTGTTCA GAATGTATCC CCCCTCCTTT TACATACTTT
CTTATAATTT TAGTTTTCCT AACAGCTTCG CATTTTTGTG TTCTTTGGAA ACTTAATGCT TCACAGAGAT TAAAAGAATT
ACATGCTAAA GAACCACCTT CTGAAGGTAA GATGCTGCGA TTAAGTGTTG AAGCTGGTGG ATGTTCTGGA TTCCAATATT
CTTTCTCTCT TGATGACAAG AAAAACTCAG ATGATCGGTA TGCCAATTTT CCTGACTGGT TTGTCCATTT TAGACAAGTG
TAAATTCTGT ATTTCTTCTA AGCATTATTG TGGAAACTTA TGAACAGAGT GTATACCTTA TAGATGATTT ATGTAGTGAG
TGTGTCACAT ACTTCATCAA TAGTTTTACT TATCTCAACA ATTGTTGTTA CACATGTAGG ATCTTTGAGA AAGAAGGTGT
TAAATTGGTT GTGGACGATG TCTCATATGA CTTTGTGAAA GGTGCCACTG TGGATTATGA GGAAGAACTT ATACGCTCCG
CATTCGTGGT TAGTTTAAAT TTGACCTATT TGATTCTTGA TTTGAATACT CTCACCATGG AAACATGTTT GGTCAAATCT
TCTGCTGGAT ACCAAAGTAG TTAGTTGAGA AAGATGTCAG AACTTCTCCT AGTTTGGTCA AATAAAATCC TTTTCCTCTT
CCACCATATA TGTTTCTCTG GCTCTTCTTC ATCATGACAA GTGCACACAT GGTTTCTCTG GTCTGGAGGG GTTATTGGTG
GACTGGGGAC GTTTAGGTGT TAGGGATACA TTATTTTAGA ATTAGTTATC CTCCTTGCCC TTTGGGTGTT AGGGAGAGGT
TACTTTACAA ATACTTGTCA ACCTTGCCAC TTCCATGAAT TTTTTGCTCT ACAGCAATCA AGCATACATT CAACATGATA
TTGTTCTAAA GTTTGGATTC AGAATGTATT GTATTTATAT ACATTGGGTA CAGCTTATAT TACTTGTAAT CTTGCAGGTA
TCAACAAATC CTAGTGCAGT TGGGGGCTGC AGTTGCAAGA GTTCTTTTAT GGTCAATTAG TTTCAGCTTT AGTAGCTTGA
TGAGATAGGT AATATGTGAT AGCATTCTGT ATTGAAATAT ACTTCATTGA TACATGTGTA CAATTTGGTA TATTTGGTGG
TTCCAAAGAT GTTATTTCTA CTGCTTCTAC CTTGTGATCC TTGTGATTAC AAGTTATGTA TACTGAATCA TTTGGCCTTC
AGTATTTATT TGTATGTTGC TTCTTTCAAA GTGCTAAATA AGATGCAATC TTTTGTAACA TTG