Os08t0374400-00

Locus

Os08g0374400

Description

Chaperone DnaJ, C-terminal domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjB9, OsSTA211

Oryzabase Gene Name Synonym(s)

DnaJ domain protein B9

Transcript Evidence

AK374926 (DDBJ)

Protein Evidence

NP_001061666.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Chaperone DnaJ, C-terminal (IPR002939)

HSP40/DnaJ peptide-binding (IPR008971)

Expression Databases

TENOR (Os08t0374400-00)

Others

Oryzabase (12157)

Transcript

1187 bp

>Os08t0374400-00 Chaperone DnaJ, C-terminal domain containing protein.
CTACTACGAGATCCTCCATGTCGACCGGAGCGCCACCGACGACGACATCCGCCGCGCCTA
CCGCCGCCTCGCCATGCGGTGGCACCCCGACAAGAACCACACCGGCAAGAAGGACGCCGA
GGCCAAGTTCAAAGACATCACCGAAGCCTACAACGTATGTCAGATCGATCGATCGATCGA
TCGGTTATTTGTTCTTGCGAATTAATCTCCTCGATCTTGCCATGCATACGTGCACGGTTT
CGGGTTTTGATCGTATATATGATTCTTTTTTGACGAATTCGATGTGTGGTGATCAATGGA
TGGATGGTCAGGTGCTCAGCGACGCCGGGAAGAGGGCGCTGTACGACCAGTACGGGGAGG
AGGGGCTCAGGGCCGGTGGCGCGCCGCCGCAGCCCGGCGGCGGCGGCGGCGGCGCTGACG
ACATCTTCGCCGAGTTCTTCGGGAGCACGCCGTTCACGTACTGCAACACGGGCGCCGGCA
CCACGGCGCGCGCCAAGCAGCAGGCGGCCTGGGACGCCGGTGGCGGCGGCGCGTACTTTG
GAAGAGGCGGGTTCGCCCGTGACCACGGCGGCGGTGGCGCGGCGGCGTCGCCCCAGCCGC
CGCCGGTGGAGAGCAAGCTGGCGTGCACCCTGGAGGAGCTCTACGTCGGCGTCACCAAGA
ACATGAAGATCTCCCGCAACGTCGTCGATGCTAGCGGGAGAATGAAAACGGAGTCGGAGA
TTCTGTCGATCGAGGTGAAGCCGGGGTGGAAGAAGGGGACCAAGATCACGTTCCCGGGGA
AGGGGAACCAGCAGTGGAGCCAGCTCCCCGCCGACCTGGTGTTCGTCGTCGACGAGAAGC
CGCACGACGTGTACCGCCGCGACGGCAACGACCTGGTGGCGGAGGCCCGGGTCACGCTGG
CCGACGCGCTGGGCGGCACGGTGGTCGTCCTCGCCACGCTCGACggccgcgagctgctgg
tggaggtgagcggcggcggtgtcgccgccggcgacgaggacgacgacGACGAGGACCCCG
TGGTGTACCCCGGGTACGAGCTGGTGGTGCCGTCGGAGGGCATGCCAATCGCCCGCGAGC
CCGGCCGCCACGGCAGCCTGAGGATCCGGTTCGACGTCGCGTTCCCGGAGCGGCTGACGC
GGAGGCAGCGCGCGCAGATCAAGCGCATCCTCGACGCCGCCGGCTAG

CDS

1170 bp

>Os08t0374400-00 Chaperone DnaJ, C-terminal domain containing protein.
ATGTCGACCGGAGCGCCACCGACGACGACATCCGCCGCGCCTACCGCCGCCTCGCCATGC
GGTGGCACCCCGACAAGAACCACACCGGCAAGAAGGACGCCGAGGCCAAGTTCAAAGACA
TCACCGAAGCCTACAACGTATGTCAGATCGATCGATCGATCGATCGGTTATTTGTTCTTG
CGAATTAATCTCCTCGATCTTGCCATGCATACGTGCACGGTTTCGGGTTTTGATCGTATA
TATGATTCTTTTTTGACGAATTCGATGTGTGGTGATCAATGGATGGATGGTCAGGTGCTC
AGCGACGCCGGGAAGAGGGCGCTGTACGACCAGTACGGGGAGGAGGGGCTCAGGGCCGGT
GGCGCGCCGCCGCAGCCCGGCGGCGGCGGCGGCGGCGCTGACGACATCTTCGCCGAGTTC
TTCGGGAGCACGCCGTTCACGTACTGCAACACGGGCGCCGGCACCACGGCGCGCGCCAAG
CAGCAGGCGGCCTGGGACGCCGGTGGCGGCGGCGCGTACTTTGGAAGAGGCGGGTTCGCC
CGTGACCACGGCGGCGGTGGCGCGGCGGCGTCGCCCCAGCCGCCGCCGGTGGAGAGCAAG
CTGGCGTGCACCCTGGAGGAGCTCTACGTCGGCGTCACCAAGAACATGAAGATCTCCCGC
AACGTCGTCGATGCTAGCGGGAGAATGAAAACGGAGTCGGAGATTCTGTCGATCGAGGTG
AAGCCGGGGTGGAAGAAGGGGACCAAGATCACGTTCCCGGGGAAGGGGAACCAGCAGTGG
AGCCAGCTCCCCGCCGACCTGGTGTTCGTCGTCGACGAGAAGCCGCACGACGTGTACCGC
CGCGACGGCAACGACCTGGTGGCGGAGGCCCGGGTCACGCTGGCCGACGCGCTGGGCGGC
ACGGTGGTCGTCCTCGCCACGCTCGACggccgcgagctgctggtggaggtgagcggcggc
ggtgtcgccgccggcgacgaggacgacgacGACGAGGACCCCGTGGTGTACCCCGGGTAC
GAGCTGGTGGTGCCGTCGGAGGGCATGCCAATCGCCCGCGAGCCCGGCCGCCACGGCAGC
CTGAGGATCCGGTTCGACGTCGCGTTCCCGGAGCGGCTGACGCGGAGGCAGCGCGCGCAG
ATCAAGCGCATCCTCGACGCCGCCGGCTAG

Protein

390 aa

>Os08t0374400-00 Chaperone DnaJ, C-terminal domain containing protein.
MSTGAPPTTTSAAPTAASPCGGTPTRTTPARRTPRPSSKTSPKPTTYVRSIDRSIGYLFL
RINLLDLAMHTCTVSGFDRIYDSFLTNSMCGDQWMDGQVLSDAGKRALYDQYGEEGLRAG
GAPPQPGGGGGGADDIFAEFFGSTPFTYCNTGAGTTARAKQQAAWDAGGGGAYFGRGGFA
RDHGGGGAAASPQPPPVESKLACTLEELYVGVTKNMKISRNVVDASGRMKTESEILSIEV
KPGWKKGTKITFPGKGNQQWSQLPADLVFVVDEKPHDVYRRDGNDLVAEARVTLADALGG
TVVVLATLDGRELLVEVSGGGVAAGDEDDDDEDPVVYPGYELVVPSEGMPIAREPGRHGS
LRIRFDVAFPERLTRRQRAQIKRILDAAG*

5'UTR

chr08:17540890..17540906 (- strand) : 17 bp

CDS

chr08:17540210..17540889 (- strand) : 680 bp

chr08:17538431..17538920 (- strand) : 490 bp

FASTA

>Os08t0374400-00 class=Sequence position=chr08:17538431..17540906 (- strand)
CTACTACGAG ATCCTCCATG TCGACCGGAG CGCCACCGAC GACGACATCC GCCGCGCCTA CCGCCGCCTC GCCATGCGGT
GGCACCCCGA CAAGAACCAC ACCGGCAAGA AGGACGCCGA GGCCAAGTTC AAAGACATCA CCGAAGCCTA CAACGTATGT
CAGATCGATC GATCGATCGA TCGGTTATTT GTTCTTGCGA ATTAATCTCC TCGATCTTGC CATGCATACG TGCACGGTTT
CGGGTTTTGA TCGTATATAT GATTCTTTTT TGACGAATTC GATGTGTGGT GATCAATGGA TGGATGGTCA GGTGCTCAGC
GACGCCGGGA AGAGGGCGCT GTACGACCAG TACGGGGAGG AGGGGCTCAG GGCCGGTGGC GCGCCGCCGC AGCCCGGCGG
CGGCGGCGGC GGCGCTGACG ACATCTTCGC CGAGTTCTTC GGGAGCACGC CGTTCACGTA CTGCAACACG GGCGCCGGCA
CCACGGCGCG CGCCAAGCAG CAGGCGGCCT GGGACGCCGG TGGCGGCGGC GCGTACTTTG GAAGAGGCGG GTTCGCCCGT
GACCACGGCG GCGGTGGCGC GGCGGCGTCG CCCCAGCCGC CGCCGGTGGA GAGCAAGCTG GCGTGCACCC TGGAGGAGCT
CTACGTCGGC GTCACCAAGA ACATGAAGAT CTCCCGCAAC GTCGTCGATG CTAGCGGGTA ATTATAAAAA TGATTTTTTT
TTAATCTTGG TTCCAAATTT GTGCAGTAAT TTTTTTATTA CATGACAAAG ACATATCCAA CATGACACTC GCACACCAAC
AAATACGCAC CTCAAAGAGA AAGAAACTAG TGGCACATCA TATCTCACTG AATTCTGCTC CATCCAttaa tattataagt
cattttattt ttttttctag ctaagtttga gcaagtttat ggaaaaatat attaacactt tcaacacaaa acaaatatat
aatcaataga tattccatgt aagatcttat taaactactt tggtatttta gatcttgcta aatttttcta taaacttgaa
caaacttgac taataaaaaa gtcaaacaat ttataatatg aaatggaagg agtaTTGAAA CTTGCATGCG AGAAGGCTAA
GGGGTGAACG ATCACTGGCA GCGATCAGCT GATCCCCCCC CTCCCCACCC CCTTCCTCCA CGTGGTTTTT TTTTTTTTTT
GCACCGTATT ACTTTCCTAT TTTAGtaaat ttatgcatcc aaagtttgta catctcaagt ttacgcatct aaatttgaaa
ccaaaagttt ataagtcaaa agtttatata tccgattcaa atttgaattt gaattcaaat atttttatat atagtgtatt
tctatacatc taaagtttat acacctaaat tttatagacc caaactttat aagtcaaaag tttacatacc cgtttcaaat
ttgaatttga attcaaatat tagtttatag acccaaagtt tattagccaa aagtttatat acccatttca aatttaaatt
tgaattcaaa tattagttca aagacccaaa gtttataagt caaaagttta tatacccgtt caaatttgaa tttgaattca
aatattagtt tatataccca aagtttataa gtcaaaagtc aaaagtttac atacctattt caaatttgaa tttgaattca
aatatttttT TATATATAGT ATTTTAATAC ATAAATTTTT TTAACTTTAT TTTTTTTAAA AAAAAATTTA TGGTGTAGTA
GGAAGAGAAG AAGGAGAGGA GTAGTGTATA GGGGGCTGGG GGTGATAGCT GTGGCTGATC ACCTGCCCAT TAGCCATGCC
CACTTGTATG TGCGTGAAAT TTATAGATAT TCGATTTGAA CATTATCGGC AGGTAGAGCG ATGCACTCAC AACTTCACCA
CCGTACCACC AGTTCTTTTC TAAATTTGTG CCGAATTTAA AACAGTTTGT AAATAATTTG GTACAGGAGA ATGAAAACGG
AGTCGGAGAT TCTGTCGATC GAGGTGAAGC CGGGGTGGAA GAAGGGGACC AAGATCACGT TCCCGGGGAA GGGGAACCAG
CAGTGGAGCC AGCTCCCCGC CGACCTGGTG TTCGTCGTCG ACGAGAAGCC GCACGACGTG TACCGCCGCG ACGGCAACGA
CCTGGTGGCG GAGGCCCGGG TCACGCTGGC CGACGCGCTG GGCGGCACGG TGGTCGTCCT CGCCACGCTC GACggccgcg
agctgctggt ggaggtgagc ggcggcggtg tcgccgccgg cgacgaggac gacgacGACG AGGACCCCGT GGTGTACCCC
GGGTACGAGC TGGTGGTGCC GTCGGAGGGC ATGCCAATCG CCCGCGAGCC CGGCCGCCAC GGCAGCCTGA GGATCCGGTT
CGACGTCGCG TTCCCGGAGC GGCTGACGCG GAGGCAGCGC GCGCAGATCA AGCGCATCCT CGACGCCGCC GGCTAG

Locus: Os08g0374400

Loading...

Locus: Os08g0374400

Loading...