Os08t0374800-01

Locus

Os08g0374800

Description

UDP-glucose epimerase, Modulation of cellulose biosynthesis and wall assembly, Cell wall formation and photosynthesis

RAP-DB Gene Symbol Synonym(s)

Osfc24, OsUGE2, FC24/OsUGE2

RAP-DB Gene Name Synonym(s)

fragile culm 24, UDP-glucose epimerase 2

CGSNL Gene Symbol

FC24

CGSNL Gene Name

FRAGILE CULM 24

Oryzabase Gene Symbol Synonym(s)

OsUGE2, UGE2, OsFC24, BZ1, OsBZ1

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 2, fragile culm 24, brittle stem and zebra leaf 1

Transcript Evidence

AK066269

Protein Evidence

Q6ZDJ7

Literature

PMID: 32064495

Note

Manual Curation

February 18, 2020

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

UDP-glucose 4-epimerase (IPR005886)

NAD(P)-binding domain (IPR016040)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Full-length cDNA

J013059D16 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0374800-01)

RiceXPro (AK066269)

Others

Oryzabase (12411)

KEGG (Os08t0374800-01 (EC:5.1.3.2, EC:5.1.3.3))

Transcript

1877 bp

>Os08t0374800-01 UDP-glucose epimerase, Modulation of cellulose biosynthesis and wall assembly, Cell wall formation and photosynthesis
CTGAATCCCTCCTCCTACTCTTCTCCTCCCCACATTCCCAAAGAGAAGCTTCGCGGCCTC
CTCCTCCTCCACCTCCTCCGCATCCTCCTCCGAGCCCCCAGATCCGCCGCGCGTGCTCTC
GCGGGTGGTGGTGCTTCTGGTCTTGGGGGAGGGGAGGGGCGCGAGCGAGCGAGCGAACGA
GCGAGAGAGAGAGAGAGAGAGAGAGGAAGGGGAGGGAGAGGGAGGTGTGTGTGTGTGAGA
GAGAGAGAGATGGCGGTGGAGAAGACGGTGCCGGGCGGGGTGAGGACGGTGCTGGTGACG
GGCGGGGCGGGGTACATCGGCAGCCACGCCGTGCTGCAGCTcctcctcgccggattccgc
gccgtcgtcgtcgacaacctcaacaactcctccgagctcgccgtccgccgcgtcgccgcc
ctcgccggcgaccactcccggaacctcgccTTCCACAAGGTTGACCTCCGTGACAAGGGA
GCACTGGAAAAGGTTTTTGCTTCAACAAGATTCGATGCTGTAGTTCACTTTGCTGGGCTA
AAAGCTGTGGGCGAAAGTGTGCAGAAGCCATTGCTTTATTACGACAACAATGTTAATGGA
ACAGTAAATCTTCTGGAAGTTATGTCTGCCCATGGATGTAAGAAGTTGGTGTTCTCATCA
TCAGCTGCAGTTTATGGATCACCGAAGAACTCACCCTGCACAGAAGAGTTTCCTCTCACT
CCAAACAATCCATATGGCAAAACAAAGCTTGTTGTTGAAGATATTTGCCGTGATATCTAC
CGTACAGATCCTGAATGGAAGATTATTCTACTTAGGTACTTCAATCCAGTTGGGGCTCAT
CCTAGCGGATACCTTGGGGAAGATCCATGTGGCATTCCCAACAATCTTATGCCTTATGTT
CAGCAAGTTGCTGTTGGCAGGAGGCCAGCTCTGACAATACTAGGAAATGATTATGCAACC
AGAGATGGTACCGGGGTCCGAGATTACATCCATGTGGTTGACCTTGCTGATGGACATATT
GCGGCATTGCAGAAACTCTTTGAGAGCTCCAGCATAGGGTGTGAAGCATACAACCTTGGA
ACTGGTAAAGGTACCTCTGTGCTGGAGATAGTCAAGGCATTTGAGAAGGCTTCTGGGAAG
AAAATTCCTCTGATTATTGGCCCAAGACGCCCTGGTGATGCGGAGATTCTATTTTCATTA
CCTGCTAAAGCAGAGAAGGAACTCAACTGGAAAGCGAAATTTGGCATCGATGAAATGTGT
AGGGATCAATGGAACTGGGCTAGCAAGAACCCTTATGGATACGGGTCACTTGACTCCACC
AAGCAGAACGGACACCACTCGTACGGATCAATTGGCTCTCCCAAGCAGAATGGCCACTGC
ACAAATGGATTTTCTGAATCCACTAGGCATAATGGTCACAACGGATATGGACTGGTCGAC
TCTGCCAAGCATAACGGCAACGGCCACTTCCACTGACCATGCTTCAGCCTTGAGTTGGCC
TGTGGGCTCCTTGTACATGTGATGTATCGAAACGATGATCCGAGATCGTTGCAGGTCAAC
GATGGATTGGCAGGTCACACGAACATGGTCGAGCTTAGATAATATTCTTTCATTGTTCAT
CGTTGGCTGAAGAATCCCACTGCCTGTGGGTATATATTTATCTCCTACTTTGAGTGTATT
ATTTTTCTTTCAGATTTGTTGTAGGAATGTGACATTTAGCCAACCAGCTGATTCGATTCT
TTCACTGCTAATTGAGCTGCATTATCTGTTACAGAGCTTTGACTGATTCCTGTACCATAT
ATCTCTTTTTGTGTATTTTATGATGTAATATTTATGAAGGGGAATTAGTCTAAAACCGAT
GCTCATGTTTTCTCTTC

CDS

1227 bp

>Os08t0374800-01 UDP-glucose epimerase, Modulation of cellulose biosynthesis and wall assembly, Cell wall formation and photosynthesis
ATGGCGGTGGAGAAGACGGTGCCGGGCGGGGTGAGGACGGTGCTGGTGACGGGCGGGGCG
GGGTACATCGGCAGCCACGCCGTGCTGCAGCTcctcctcgccggattccgcgccgtcgtc
gtcgacaacctcaacaactcctccgagctcgccgtccgccgcgtcgccgccctcgccggc
gaccactcccggaacctcgccTTCCACAAGGTTGACCTCCGTGACAAGGGAGCACTGGAA
AAGGTTTTTGCTTCAACAAGATTCGATGCTGTAGTTCACTTTGCTGGGCTAAAAGCTGTG
GGCGAAAGTGTGCAGAAGCCATTGCTTTATTACGACAACAATGTTAATGGAACAGTAAAT
CTTCTGGAAGTTATGTCTGCCCATGGATGTAAGAAGTTGGTGTTCTCATCATCAGCTGCA
GTTTATGGATCACCGAAGAACTCACCCTGCACAGAAGAGTTTCCTCTCACTCCAAACAAT
CCATATGGCAAAACAAAGCTTGTTGTTGAAGATATTTGCCGTGATATCTACCGTACAGAT
CCTGAATGGAAGATTATTCTACTTAGGTACTTCAATCCAGTTGGGGCTCATCCTAGCGGA
TACCTTGGGGAAGATCCATGTGGCATTCCCAACAATCTTATGCCTTATGTTCAGCAAGTT
GCTGTTGGCAGGAGGCCAGCTCTGACAATACTAGGAAATGATTATGCAACCAGAGATGGT
ACCGGGGTCCGAGATTACATCCATGTGGTTGACCTTGCTGATGGACATATTGCGGCATTG
CAGAAACTCTTTGAGAGCTCCAGCATAGGGTGTGAAGCATACAACCTTGGAACTGGTAAA
GGTACCTCTGTGCTGGAGATAGTCAAGGCATTTGAGAAGGCTTCTGGGAAGAAAATTCCT
CTGATTATTGGCCCAAGACGCCCTGGTGATGCGGAGATTCTATTTTCATTACCTGCTAAA
GCAGAGAAGGAACTCAACTGGAAAGCGAAATTTGGCATCGATGAAATGTGTAGGGATCAA
TGGAACTGGGCTAGCAAGAACCCTTATGGATACGGGTCACTTGACTCCACCAAGCAGAAC
GGACACCACTCGTACGGATCAATTGGCTCTCCCAAGCAGAATGGCCACTGCACAAATGGA
TTTTCTGAATCCACTAGGCATAATGGTCACAACGGATATGGACTGGTCGACTCTGCCAAG
CATAACGGCAACGGCCACTTCCACTGA

Protein

409 aa

>Os08t0374800-01 UDP-glucose epimerase, Modulation of cellulose biosynthesis and wall assembly, Cell wall formation and photosynthesis
MAVEKTVPGGVRTVLVTGGAGYIGSHAVLQLLLAGFRAVVVDNLNNSSELAVRRVAALAG
DHSRNLAFHKVDLRDKGALEKVFASTRFDAVVHFAGLKAVGESVQKPLLYYDNNVNGTVN
LLEVMSAHGCKKLVFSSSAAVYGSPKNSPCTEEFPLTPNNPYGKTKLVVEDICRDIYRTD
PEWKIILLRYFNPVGAHPSGYLGEDPCGIPNNLMPYVQQVAVGRRPALTILGNDYATRDG
TGVRDYIHVVDLADGHIAALQKLFESSSIGCEAYNLGTGKGTSVLEIVKAFEKASGKKIP
LIIGPRRPGDAEILFSLPAKAEKELNWKAKFGIDEMCRDQWNWASKNPYGYGSLDSTKQN
GHHSYGSIGSPKQNGHCTNGFSESTRHNGHNGYGLVDSAKHNGNGHFH*

5'UTR

chr08:17576154..17576402 (- strand) : 249 bp

CDS

chr08:17575944..17576153 (- strand) : 210 bp

chr08:17573322..17573371 (- strand) : 50 bp

chr08:17573060..17573195 (- strand) : 136 bp

chr08:17572795..17572896 (- strand) : 102 bp

chr08:17572476..17572703 (- strand) : 228 bp

chr08:17571660..17571741 (- strand) : 82 bp

chr08:17571183..17571265 (- strand) : 83 bp

chr08:17570806..17570897 (- strand) : 92 bp

chr08:17570487..17570730 (- strand) : 244 bp

3'UTR

chr08:17570086..17570486 (- strand) : 401 bp

FASTA

>Os08t0374800-01 class=Sequence position=chr08:17570086..17576402 (- strand)
CTGAATCCCT CCTCCTACTC TTCTCCTCCC CACATTCCCA AAGAGAAGCT TCGCGGCCTC CTCCTCCTCC ACCTCCTCCG
CATCCTCCTC CGAGCCCCCA GATCCGCCGC GCGTGCTCTC GCGGGTGGTG GTGCTTCTGG TCTTGGGGGA GGGGAGGGGC
GCGAGCGAGC GAGCGAACGA GCGAGAGAGA GAGAGAGAGA GAGAGGAAGG GGAGGGAGAG GGAGGTGTGT GTGTGTGAGA
GAGAGAGAGA TGGCGGTGGA GAAGACGGTG CCGGGCGGGG TGAGGACGGT GCTGGTGACG GGCGGGGCGG GGTACATCGG
CAGCCACGCC GTGCTGCAGC Tcctcctcgc cggattccgc gccgtcgtcg tcgacaacct caacaactcc tccgagctcg
ccgtccgccg cgtcgccgcc ctcgccggcg accactcccg gaacctcgcc TTCCACAAGG TCGGTCACTT GCAAATGCTG
CCCCTGCCCC TGCCCATCCG CCTCCTCCTC CTCCATGGAT CTCTCCCTCT CCGTGCAATG CCTCAATTAT TTTTATTTTT
TTAAACAAAA ACTTTTTCTG GTGCGGCTAG ATCTCTGCAG AGTCCTGCGT GCTACAGTCT CCGCACAGAA CTTCACAATG
TTGAGTTCTT TTTTCCCATT ATTTTTCGCT GCATTGATTG CTTGATTTTA CCTGATAACC AAGTGGTTTT ACCTTCAAAT
TTCTCGACTG CTAATTGGGA AATGTCTGGC TGTGCCACAT TTCCGATTTC TACTCGGTAC GGTTCTTTTG GATGTTCCCA
TCTTACTAGT ATTATTAAGT TAGTTTTGAC TATGGTGTTA GTTTAATAAA TGGCGATGCG GTGTTGTCGC AATTTATGGC
AATTGAAACA AAAATGGCGT TGCGAGGATA GCTGGTGCTT CAACGTTTGA TTTGCTGCTA GATGTTAAGG TTGTTTTCCC
CTTTTCTAGC TAGAATTTAG GACTCCTTTC TTCATTCTAC TTGGTTAGAG GGGAAAATGC CAGCGTATTT TGGTTTCGAT
TCGAAACCTG TCTTCTAATT CGTGTGCCAG ACTGCCAGAT TGTCGGAGAT ATTGGCTATT GGGGATTTAA TACATCACCT
GATGTCAGGA AAAAAACAGT AATTCATTGG CGTTAATAAT TGCGTAATAC AGATTTGTTA TTCTGGCTGT TATCTGAAAA
ACAAATTTGT TACTCTTGTG GCAATTATTT GATGTCTCAG TGGTTCTTCA ATGGGGAATT ACCGGTCATT TTGACTGTAA
TTGTTTAACC AAGAGTGTTT GTGCGGTACG CACAATAATC CTGGCATGTA GGCAACTGCC AAAGTCTACT TTTAATTGTA
GGGAATGGGT TTGCTATTGC TTTGCAGTTG TCAAATTGGA TTGTTTGCAT GTGACATTGT CTCCCCCAGC TGATTTGTTT
AACTCTTCCC TGTTGGCACT GCCAACTTTG CACAATTGGC ATTCATTTGG TAGCTCTGAT TGATATGCTG TCCTAATTAT
TACAATTAGA GTGGTTGGCT AATTTAAACA CCGTCACAGC TAGCATTTGA AAAGTACCTT CCTTTTTTTA GCTAATTTTT
AAAGCTCATA GGGCAACTCT GTACTGATAG TACTATGGTA GTTAGCTTGG ATTTGATATG TGATCACTTA TCAGTGATAT
ATTCCAATGA AATGCTTGTA ACATTATAAG AGCTGCCTTA GTGGATCCCA GAAGGACAAC CAAAAAGGGA GGGGAAAACT
AGATGATTGC TTTGCTAATT ATGCTTGCTC TGATGACCTG CCCTTTCTCC TTTTAAGTGG GCTTTGACTT TTTTTTTGCC
CAGAAGCTAA TGGATATCAT GTTGATAAAA GAGCAGCTTC TATATCCATT CCTTGAAAAG AACAGGGCCA TAGAAGTACT
GATTTATACT GGTTGCAGAA TTCTGTATGT CGCATGAAGG TATTATTGTT AGTCAAACTG TATGGAAGAT CCATAGATTG
ACATTGTAGG GTCCATCATC CCATTTGAGA CCATTATAAC ACATTTTTTT TCTTTTTATT TGATTCCATT GAATGATGTT
CTGAACTAGA AGCCCTTTTT GGTTGAACTC ATAATATCAG GTTTTAAACT ATAAACCATT TTCTTGTTAA ACATTAAAAT
CGTGTTCTGA ACCGGGACCA ATAATTTTTG AAATCAAACT TAGTATCATT GGTACATATT TGCTTATCAT TAGCATTATG
TGCTTTTGCT TTAAGATTCG CAGGGTTTTC TTTTGGTTGC TACTGAAGTG GGATCAATAT TTAGTACCCT GCTGTCCTGT
GATGTCTGAC TGTATCTGTA TCTCCTGGTG AAATTTGCTT CAATTTGTTC TAGGTGCACA TCTGTTGTTA TTTGTGTTTA
AGTCAATGAG ACAATTGGAG TTCTGCTATT TGGTCATTCA TTGCCTTGTA AAAGTGCATC TATTGAAAGT GCATCTATTG
ACAAGTTAAC TTTGTAGATT TCTCTTTGAA CTTGCCAGAC AGAACCTTAT AATTCTTTGT TACTAGTCTG CATTTCATAT
CCCTGAAAAA TTCATCTAAA TTTGGCAGAG GAATTTCTTG GAGGAGCAAG TTATGTACCT TCGCATTCAG AGAAATGCTA
ATGGTCTCTT TGGCAGCATA ACTCCTATGC CTTTGTTCCT AGTCATGTGT CAGGAAGTGT GTTTAGAGTG AAATACACTG
CACTAGTCAG AAAACGTAAT TTGATATGAG TAATGTCTGA TGTAGTTGTG ATTGTTTGGT ATTTCAACTC GGTATGATGA
TTTCATGAAA GCAGCTTCTC TTGTTCTGTG ATCTTGCTTT CTTTTTCCTA CAAGATTAGA TATGGCTTCA TGAATTTTGA
TTCTCATTAT GTGATTGTAC TACAATTTTA AAAATGTTTA CTGTCGAAAG CATTATATTT TTTTTCTTCC CCTTTTAGTC
TCATTCTGAA AAACTATCTA AAAGTTCATG GACATGGATG CAACTTACCA CCATTACTAA TGCTTTTGCA GGTTGACCTC
CGTGACAAGG GAGCACTGGA AAAGGTTTTT GCTTCAACAA GGTAAAACGT ACTGGTTTTT TAGTTATGGT ATCTTTACTT
TATCTGGATG CTTTTCTGTT TCCTTGCATG CAGAGGCATG CCCATCATCA TTACTTGTTC TTTATTGTTA GCTTCTTTGC
TTTTCAGATT CGATGCTGTA GTTCACTTTG CTGGGCTAAA AGCTGTGGGC GAAAGTGTGC AGAAGCCATT GCTTTATTAC
GACAACAATG TTAATGGAAC AGTAAATCTT CTGGAAGTTA TGTCTGCCCA TGGATGTAAG AAGGTATTTA TCCTTTGCAC
TTTGATACAC ATAGTAACAT CAAGCTCTGT GGACTGTACT TACAACAAAT AGGTTGGATT TTGATATTTT TATTTCGCTG
GTTACCTTTA GACTCTGGCA TTGACATACT GTTCCTCCTT TTTTTTTGTA TGTTCAAATG TTGTAGTTGG TGTTCTCATC
ATCAGCTGCA GTTTATGGAT CACCGAAGAA CTCACCCTGC ACAGAAGAGT TTCCTCTCAC TCCAAACAAT CCATATGGCA
AAACAAAGGT CTGTGTCCCT TCACTTTTCT TTTAATGAGA AAATCTTCTA CCATTCATAA GTTCTCCAAA TTGACTACAA
TTGTAAAAAT GAACTGCAGC TTGTTGTTGA AGATATTTGC CGTGATATCT ACCGTACAGA TCCTGAATGG AAGATTATTC
TACTTAGGTA CTTCAATCCA GTTGGGGCTC ATCCTAGCGG ATACCTTGGG GAAGATCCAT GTGGCATTCC CAACAATCTT
ATGCCTTATG TTCAGCAAGT TGCTGTTGGC AGGAGGCCAG CTCTGACAAT ACTAGGAAAT GATTATGCAA CCAGAGATGG
TACCGGGGTA ATGCTTTTCA CATGTATATT CAATTTGTCA TTATTTGCGT CTGTTTAAAT TTGATTAATC CATGTTAGTA
CCTTTCAAGA TTCTGATTCT CATGTTACGT TGTTAGAAAT TAGCTTTATT TTCCTTCAGG ATATGTCCTT GGGGGATGAG
ACTTGAATAT TTGGCAAAAT AGTCAGTTAC TGATTGTATC TGCTGCTTGG AACTGTCTGT TCATTTATGA TATCTAATAA
GACTGTGTCC AATGTATGTG ACAATGTAGT ATTTCCTAAG AAACAAAGAA AGATAACAAA TTAAAAGACT CGTAATATTT
TTTTTCACCA AAGGTGTGTG CCCATCCAGT ACTTTTACTA AGTGTGTTCA TGCAATTTGC TCTTTGCTAC CTTAGTCAGC
TCTCTGGCCC CACATTTCTA GGAACCTTTT TTGAAGCTGC TATGCTTCTA TGGATATGTG TGTTTGTTGT ATCGTGTCAG
GTTACCTTGA ATTCTCCATT TAGGGCATCT CATTGAACTA TTGGGCAAAT ACTTGCAAGG GATAGTATAA TGTGCATTTA
CTTATGTCAA TACTTCTTCA TTTCAAAACG TATTTATTCA TCTGACAGTT CTAGTTATAA CCTCTTTTTT AGATATGGGA
TATTAAGTTA TAACCTCTGA TATTTGGGCT GTTGTAATAA CAGTGATTCG CATGTGTCAT GGCAACCTTT CATTGTTTAA
TGACACTTAC ATGATTTACA GGTCCGAGAT TACATCCATG TGGTTGACCT TGCTGATGGA CATATTGCGG CATTGCAGAA
ACTCTTTGAG AGCTCCAGCA TAGGTTAGTC CCTGGCCTTA GATGATTTTT GAATACTTAT TTGCTAGTGC TTTTTACCTC
TTTTCAGATG CAGTAACTAG CCGCTTTTAT GTTTATTGCA TGTTTATTTA GGATATTAAA TTTTAGTTGG ACGAACACAA
AACCCTTGTT GTAAATGAAC TTGTATAAGA AACATTCTTT CTTGATAGAT AGATATATAA GTTTATCATG TGTAGCAATA
CTTACCATTT TATGTAGCTT ATATTTGATC TTAGAACCCC AGGTAAACAA GGATATCTCT TTGGGGGTAT ACATAATCTA
ATTTATTGTT CTTCTTGGGC AACATGAAAC TAGAGGGATT GGACTTTATT TATTTATTTT TATTTGAACC ATGTTTTGAA
CTTTATTGTA CTTGCAGGGT GTGAAGCATA CAACCTTGGA ACTGGTAAAG GTACCTCTGT GCTGGAGATA GTCAAGGCAT
TTGAGAAGGC TTCTGGGAAG GTATGCTAGA TTGATGTATA ATATGGGAAA TTATCTTTTT CCACTAACTA GGTGCATTTT
AAGGCACAGT ACTTTTCTGT CATGGTAGTA CTAATCAGTA TGCATTAATT TATATATGAA TAGTACCACA ATGCTAAGCT
CTTGTCTTGC CTGTTGAGCC TTGTATGTGC TTAAGTTTTT TTGCTTAGGT GATTGTTAGC ATTTATTGTA GATAAAATGC
TTTCTCCAGC TTGCGCGCCT TGCCAGGATT TGCTTTGTTC TTATTTTTTT TAATTGCTGT GCTAGAAAAT TCCTCTGATT
ATTGGCCCAA GACGCCCTGG TGATGCGGAG ATTCTATTTT CATTACCTGC TAAAGCAGAG AAGGAACTCA ACTGGAAGTA
AGTTTTACAT CAACGGATAA TCACATGAAC CTTTTTCTTG GTTTCCACCT AACTGGTATT GTCTTTCCCC AGAGCGAAAT
TTGGCATCGA TGAAATGTGT AGGGATCAAT GGAACTGGGC TAGCAAGAAC CCTTATGGAT ACGGGTCACT TGACTCCACC
AAGCAGAACG GACACCACTC GTACGGATCA ATTGGCTCTC CCAAGCAGAA TGGCCACTGC ACAAATGGAT TTTCTGAATC
CACTAGGCAT AATGGTCACA ACGGATATGG ACTGGTCGAC TCTGCCAAGC ATAACGGCAA CGGCCACTTC CACTGACCAT
GCTTCAGCCT TGAGTTGGCC TGTGGGCTCC TTGTACATGT GATGTATCGA AACGATGATC CGAGATCGTT GCAGGTCAAC
GATGGATTGG CAGGTCACAC GAACATGGTC GAGCTTAGAT AATATTCTTT CATTGTTCAT CGTTGGCTGA AGAATCCCAC
TGCCTGTGGG TATATATTTA TCTCCTACTT TGAGTGTATT ATTTTTCTTT CAGATTTGTT GTAGGAATGT GACATTTAGC
CAACCAGCTG ATTCGATTCT TTCACTGCTA ATTGAGCTGC ATTATCTGTT ACAGAGCTTT GACTGATTCC TGTACCATAT
ATCTCTTTTT GTGTATTTTA TGATGTAATA TTTATGAAGG GGAATTAGTC TAAAACCGAT GCTCATGTTT TCTCTTC

Locus: Os08g0374800

Loading...

Locus: Os08g0374800

Loading...