Os08t0376700-01

Locus

Os08g0376700

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR8, rr8, OsRR8, Rra13, OsRR15, OsRRA13

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 8, A-TYPE response regulator 8, Type A response regulator 8, A-type RR 13

CGSNL Gene Symbol

RR8

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 8

Oryzabase Gene Symbol Synonym(s)

rr8, OsRR8, Rra13, OsRR15, RR15, OsRRA13

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 8, Type A response regulator 8, A-type RR 13

Transcript Evidence

AB249663 (Genbank)

BR000317 (Genbank)

Protein Evidence

Q8GVV6 (UniProt)

Literature

PMID: 16919402

PMID: 16472405

PMID: 17293362

Note

Manual Curation

April 23, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Expression Databases

TENOR (Os08t0376700-01)

Others

Oryzabase (8165)

Transcript

366 bp

>Os08t0376700-01 A-type response regulator, Cytokinin signaling
ATGTCGTCCCCCCATGTGCTTGTTGTGGATGATACCCATGTTGATCGCCATGTTGTTTCC
ATGGCCTTAATGCGCCATAATGTCCGAGTGACTGCAGTAGAAAGTGTCATGCAAGCATTG
ATGTTTTTGGACTCGGAACATGATGTGGACATGATTGTTAGTGACTACTGTATGCCAGAC
ATGACCGGCTATAACCTACTCATGGAAGTGAAGAAATCACCTAAACTGGCACATCTCCCG
GTTGTAATTGCTTCCTCTGATAACATCCCAGAAAGGATCAGAAAGTGCTTGGATGGAGGA
GCAAAGGATTATATTCTGAAGCCAGTCAAGATTGTTGATGTGCCTCGTATTATGAAATAC
ATATGA

CDS

366 bp

>Os08t0376700-01 A-type response regulator, Cytokinin signaling
ATGTCGTCCCCCCATGTGCTTGTTGTGGATGATACCCATGTTGATCGCCATGTTGTTTCC
ATGGCCTTAATGCGCCATAATGTCCGAGTGACTGCAGTAGAAAGTGTCATGCAAGCATTG
ATGTTTTTGGACTCGGAACATGATGTGGACATGATTGTTAGTGACTACTGTATGCCAGAC
ATGACCGGCTATAACCTACTCATGGAAGTGAAGAAATCACCTAAACTGGCACATCTCCCG
GTTGTAATTGCTTCCTCTGATAACATCCCAGAAAGGATCAGAAAGTGCTTGGATGGAGGA
GCAAAGGATTATATTCTGAAGCCAGTCAAGATTGTTGATGTGCCTCGTATTATGAAATAC
ATATGA

Protein

122 aa

>Os08t0376700-01 A-type response regulator, Cytokinin signaling
MSSPHVLVVDDTHVDRHVVSMALMRHNVRVTAVESVMQALMFLDSEHDVDMIVSDYCMPD
MTGYNLLMEVKKSPKLAHLPVVIASSDNIPERIRKCLDGGAKDYILKPVKIVDVPRIMKY
I*

CDS

chr08:17677910..17677997 (+ strand) : 88 bp

chr08:17678121..17678167 (+ strand) : 47 bp

chr08:17678254..17678331 (+ strand) : 78 bp

chr08:17678430..17678500 (+ strand) : 71 bp

chr08:17678610..17678691 (+ strand) : 82 bp

FASTA

>Os08t0376700-01 class=Sequence position=chr08:17677910..17678691 (+ strand)
ATGTCGTCCC CCCATGTGCT TGTTGTGGAT GATACCCATG TTGATCGCCA TGTTGTTTCC ATGGCCTTAA TGCGCCATAA
TGTCCGAGGT TCTTTGTTAT GCAAGTTTCC ATGTTTTTGA ATGTTGTTAA CTAAGTGTTT CCATGTTTGA AATCTTCTGA
CCTTCTTTTC GACTGTTGTT AACTAAGTGT TTCCATGTTT GATATATGCA GTGACTGCAG TAGAAAGTGT CATGCAAGCA
TTGATGTTTT TGGACTCGGT AAATTAAAAG TTTTCTACTT GTTTATTTGG TAATGTTATT TACAAACTAT ATAACAAACA
TGTATTTATG TCTGATGGAC ACAGGAACAT GATGTGGACA TGATTGTTAG TGACTACTGT ATGCCAGACA TGACCGGCTA
TAACCTACTC ATGGAAGTGA AGGTGCGTAC GTACAATAGT GTTAATCTTC ATCATATATA TTTTATAATG TTTCTACCAA
ATATTTTACA TGTTCAAATT GGGCTTGTTT TTACTCATAG AAATCACCTA AACTGGCACA TCTCCCGGTT GTAATTGCTT
CCTCTGATAA CATCCCAGAA AGGATCAGAA AGTAAGTATG ACGATGTATA CCTTGATTTC CTTAGTTGAT AGATTCTTAA
TCCGAGCATG TGGATCCTAA TATGTGCTCC CTTTTCCTTC TTTTTTTTTC CTTGTTGGAG GTGCTTGGAT GGAGGAGCAA
AGGATTATAT TCTGAAGCCA GTCAAGATTG TTGATGTGCC TCGTATTATG AAATACATAT GA