Os08t0377100-00

Locus

Os08g0377100

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFBX289, OsKIX_7, OsFbox442, Os_F0407, OsEnS-121

Oryzabase Gene Name Synonym(s)

KIX domain protein 7, F-box protein 289, F-box protein 442, endosperm-specific gene 121

Transcript Evidence

ab initio prediction

Protein Evidence

B9G0M8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box domain, cyclin-like (IPR001810)

F-box domain, Skp2-like (IPR022364)

Expression Databases

TENOR (Os08t0377100-00)

Others

Oryzabase (13461)

KEGG (Os08t0377100-00)

Transcript

975 bp

>Os08t0377100-00 Hypothetical conserved gene.
ATGGACGAGTTAGGGATCATCGAGGAAGGTGTCGATTGGAGGACCCGCCTTGGCCAGGAT
ATTCGCGATAGGGTAAAACGTGATATATTGTTCAGCCTGCAGATGAAATTGCAAACAACT
ACTTCTACAACATTGATTGATCTTCAAAAAGTTGCTGCTAGAATAGAGGAGAGAATCTAC
AAAATAGCTATTGACTTTGGTGATTATCTACGGAGGATTAGTCTGATAAAAGGCGATTTG
GATGATTCATATCCTCTGATGTTGAACAATTTTCTGCATATTCATCAGCAAGCTTCAACC
TCTTCATTTTTCTTGCTCCATCAGAAGAATAAGCAGGGCCAAATTATCCAGGCAGAAGGA
AATGTTCAGGGGACATCATCTAGCAGCCACAAGGAACCCTCCCATCCCCATGGAAAAGAT
AGGATCAGCGAACTCCCAAATGATCTGATCCACCACATAATGTCCTTCTTGTCGATGAAG
GAGGCGGTGCGCACGAGTGTCCTGTCCCACTGGTGGGTCAACAAGTGGACTTGCTTGCAG
TCAATAAAGCTTGATATAAATTGGTTTCGCCTAGATAGGGAAAAATTCCGTAGTTCTATT
GACAAACTATTGCTAAGCCGCGACCATCTTGATGCTTCTATGGATACATTCCAGCTAGAT
TCTTTTGCAGTGGACCGGGCCGGTTCTTGGATCAACCATGCTATCAAGCACAACGCTAAA
GTAGTTAAATTTTCTGAGTATCCAAGTTGGGAACCTTTTTACTTGGATCCAGAACTTGTG
GAGTTCAGTTCTCGGTATCTAAAAACATTGGAGCTGACTAATGCAGCTCTAAATGAGATG
GTATTTGATCGTCTCAATAACGCATGCCCGGTTTTGGAAAATCTGGTGGATTGGTGGTCC
GAACTCACGACCAATCAGTTGATGGCATTAGTCGAAATTAGCAGTGGAGGTTCCGTCAGT
ATTGACTTCTACTAG

CDS

975 bp

>Os08t0377100-00 Hypothetical conserved gene.
ATGGACGAGTTAGGGATCATCGAGGAAGGTGTCGATTGGAGGACCCGCCTTGGCCAGGAT
ATTCGCGATAGGGTAAAACGTGATATATTGTTCAGCCTGCAGATGAAATTGCAAACAACT
ACTTCTACAACATTGATTGATCTTCAAAAAGTTGCTGCTAGAATAGAGGAGAGAATCTAC
AAAATAGCTATTGACTTTGGTGATTATCTACGGAGGATTAGTCTGATAAAAGGCGATTTG
GATGATTCATATCCTCTGATGTTGAACAATTTTCTGCATATTCATCAGCAAGCTTCAACC
TCTTCATTTTTCTTGCTCCATCAGAAGAATAAGCAGGGCCAAATTATCCAGGCAGAAGGA
AATGTTCAGGGGACATCATCTAGCAGCCACAAGGAACCCTCCCATCCCCATGGAAAAGAT
AGGATCAGCGAACTCCCAAATGATCTGATCCACCACATAATGTCCTTCTTGTCGATGAAG
GAGGCGGTGCGCACGAGTGTCCTGTCCCACTGGTGGGTCAACAAGTGGACTTGCTTGCAG
TCAATAAAGCTTGATATAAATTGGTTTCGCCTAGATAGGGAAAAATTCCGTAGTTCTATT
GACAAACTATTGCTAAGCCGCGACCATCTTGATGCTTCTATGGATACATTCCAGCTAGAT
TCTTTTGCAGTGGACCGGGCCGGTTCTTGGATCAACCATGCTATCAAGCACAACGCTAAA
GTAGTTAAATTTTCTGAGTATCCAAGTTGGGAACCTTTTTACTTGGATCCAGAACTTGTG
GAGTTCAGTTCTCGGTATCTAAAAACATTGGAGCTGACTAATGCAGCTCTAAATGAGATG
GTATTTGATCGTCTCAATAACGCATGCCCGGTTTTGGAAAATCTGGTGGATTGGTGGTCC
GAACTCACGACCAATCAGTTGATGGCATTAGTCGAAATTAGCAGTGGAGGTTCCGTCAGT
ATTGACTTCTACTAG

Protein

325 aa

>Os08t0377100-00 Hypothetical conserved gene.
MDELGIIEEGVDWRTRLGQDIRDRVKRDILFSLQMKLQTTTSTTLIDLQKVAARIEERIY
KIAIDFGDYLRRISLIKGDLDDSYPLMLNNFLHIHQQASTSSFFLLHQKNKQGQIIQAEG
NVQGTSSSSHKEPSHPHGKDRISELPNDLIHHIMSFLSMKEAVRTSVLSHWWVNKWTCLQ
SIKLDINWFRLDREKFRSSIDKLLLSRDHLDASMDTFQLDSFAVDRAGSWINHAIKHNAK
VVKFSEYPSWEPFYLDPELVEFSSRYLKTLELTNAALNEMVFDRLNNACPVLENLVDWWS
ELTTNQLMALVEISSGGSVSIDFY*

CDS

chr08:17699204..17699289 (+ strand) : 86 bp

chr08:17700578..17700689 (+ strand) : 112 bp

chr08:17701369..17701555 (+ strand) : 187 bp

chr08:17702089..17702588 (+ strand) : 500 bp

chr08:17703547..17703636 (+ strand) : 90 bp

FASTA

>Os08t0377100-00 class=Sequence position=chr08:17699204..17703636 (+ strand)
ATGGACGAGT TAGGGATCAT CGAGGAAGGT GTCGATTGGA GGACCCGCCT TGGCCAGGAT ATTCGCGATA GGGTAAAACG
TGATATGTAA GTGCCCCCTC CTCGTCTCTC TCTTCCCCTA TTCTTACTTT TTTTTCCATG AGAAATTGAT TACAAAGTTT
TGAATTGATG ATAGTTTATT ATCAAGATTG GAAATCGTCA TCCATGCTAT ACTTGTTAAT GATCTAACTG AATCATCATA
TCGGTAGTCA GATCCAATCT GATGTTTTCT AGATTTAAGT AACAGTTAGA TTTGTTTGGT AGAGCTACAA ATCTAATATG
TAGCTGAAGT TCTGGATCCA AAAAAAGGTA GCTCCACCCT TTCTGCATAT CTTGTGGAGC AGATCCACGC ACTTCACTTT
TAGAAAACTG AGGATCTAGT ATTGTTTGGT TCAACTCCGG CTCTAACTCT GCCATATGCC CAAATCACCT AAAAATCATT
GTTGTTCTGG GCAAAACGTT GTTGATTGGA CTCAAACCTT TGTATTTTGA TCGTATCCAA GTATAAAAGG TAAGTTGTTT
CATATTTAGA AAATTACCCT AGTAAATGAA TCATCGCCAA AAGAAAATGA ACTAAGTTTG CATGTCAATA GTTCCGTACT
AAATTATGTG GCCAGTTCCT TGCATGGTGC ATGGGTATAA GCTTTATGGA CTAGTGTTTT AGTTCTGCTC CTAATTTGTT
CTGTCTTTCA AATTTTTTGG CTAGCATATT TAATTTGGAG TAGGTGTTAA AACCCTTAAG GTGATTCATG TTCCCACCTT
GAGGGAGGAG GAAGAACTGG AGAAGTCATG GTGTTGGACT GTTGGTTCTG CAATTGTGTA ACTGAGTCCA CCTTACACAA
TGAAAAATAT ATGAGATGAT GCAGCTACTC CAGAAAAAAG CAAAAATCTG TTGGTAGATA TCACTTATAG GTTTAGGTGC
TTTTTCTTTC TTTCTTTCTT TCTTTTTTTT TTTTGGGGGG GGGGGTGGAT GTAGGTGGTA AAACTTACAA GAAAGATGGT
CCCATGTTCA CACATCCATC TTGTTTTGTT TGTCGTATAC ATAATTCCTC CTTATTATTG GTTATGAATG CTCTCCTCCA
AACTCTTAGC ATACATGATG GCACAAATTT GCTAAAATAT GACACTTTTG GTTGGACAAA TGATATTTCA GTATTTATGA
GAATGTATCT ACAATTCCAA ACATGTTACT TTCACAAACA TGCATTTCTC AAACAGTGAA TATATAGCAT GCATGTATTT
CTTGACTGGC CACATTTTGG ATTAATATTA AACAGTGAAG TACCATAGTG AAATATTAAA TATGTTGTAT TAATATTTGG
TATTCTGCTT GCAGATTGTT CAGCCTGCAG ATGAAATTGC AAACAACTAC TTCTACAACA TTGATTGATC TTCAAAAAGT
TGCTGCTAGA ATAGAGGAGA GAATCTACAA AATAGCTATT GACTTTGTAC GATGGTTTGT TCTTAATAGT TTTTTATGCA
ATCAAATTTC CTTAGGTATT AAATTTTATT TTTATGTCTG TTAATGCGCG TAATAGTGTT AACCTTAATA GTAACACCTT
AATAGTGTTA ACCTTAAAGC TCCTAAACAA GTACAATAAC TTATTGCCGA GAAGTCTAGA ACTACTTAGA GCTATAACAA
TTGTGTGAGG CCGTTAGGAT GACCATCTTA CTTGAAAACA TATGGTTGCA AGATGTTCTA TGCAAATTCT GCATCTAATT
AAAAATGTTT ATTACTCTTC CTTTACTGTG GCGCAGAAGC CACTAGGATT GATGTTGTAT TTAATTGAAG TGATCGTTCA
TAAACAATTC CAATTATTTA TGTTCCCCTT TCGATTCACT TTTTATATAG TTGACAAAAA TCATCCTTTT CTGTTTTTTT
GACTTATATA TGTGCATCTC TAGAAAAAAT CTATAATATA TTGATTTTAT CCTCATATAG AAAGTACTTT GTTTAGGTTC
ATTCTCCATT CAATAATATT TGCACTTATT CTTGGCTTGC CAGATTGTGG AACACTCTCT TTGCTAACTT TGTATGTTTT
CGCTGGTATT ATAAAGTTAT GGTTCAATAT AGGATTTTAT GTTTAAATAA AAGTTCTGAT GATTTTTCTT TCTCGCACTA
CATAGGGTGA TTATCTACGG AGGATTAGTC TGATAAAAGG CGATTTGGAT GATTCATATC CTCTGATGTT GAACAATTTT
CTGCATATTC ATCAGCAAGC TTCAACCTCT TCATTTTTCT TGCTCCATCA GAAGAATAAG CAGGGCCAAA TTATCCAGGC
AGAAGGAAAT GTTCAGGGGA CATCATCTAG CAGTAAGTTC TTGAAAATTT GAACACCAGT ATGTTCTTTT TTTTTATGTT
GCCTACATGA TGTATTTTCT CCATAGTCTA CACATGATTA TAATCTTCTA GACAGGTTGA TACATGAAAA ATATATGAGA
ATAAAATTTG TAAATACACA ACCCGATCCC ATGTTTGAGT TAAAGCATTT TTCATGTTTT CATCCTTTAC ACATTGGTAA
TTTTGGTGCA AAATCGAGAA TATTTGTTAT TCTGGTGCAA CACATGATTG ATGTGTGAGC CTCACCTCCT TACTTTTTTC
TTTAAAAAAA AACGAAAAAC TCAAAGCTAC TAGGGCAATG TTTTATCATT TATGTAAAGT GTATTTAAGA TAGCAATATC
TCTGTGAATC TAGATTTAAG CCCACACAGA AATTGTAAAT TTGTTGTGAG TTGTTTGTGT GGTTCTCCAA GATCATGTAC
CTACACTAAG AAGCATGTAC TGAATCAATG TCAAAACTTG TTCACACTGA ATTTAAGTAA CTCAGTATCC AGTTCTAAAC
TGCAGGCCAC AAGGAACCCT CCCATCCCCA TGGAAAAGAT AGGATCAGCG AACTCCCAAA TGATCTGATC CACCACATAA
TGTCCTTCTT GTCGATGAAG GAGGCGGTGC GCACGAGTGT CCTGTCCCAC TGGTGGGTCA ACAAGTGGAC TTGCTTGCAG
TCAATAAAGC TTGATATAAA TTGGTTTCGC CTAGATAGGG AAAAATTCCG TAGTTCTATT GACAAACTAT TGCTAAGCCG
CGACCATCTT GATGCTTCTA TGGATACATT CCAGCTAGAT TCTTTTGCAG TGGACCGGGC CGGTTCTTGG ATCAACCATG
CTATCAAGCA CAACGCTAAA GTAGTTAAAT TTTCTGAGTA TCCAAGTTGG GAACCTTTTT ACTTGGATCC AGAACTTGTG
GAGTTCAGTT CTCGGTATCT AAAAACATTG GAGCTGACTA ATGCAGCTCT AAATGAGATG GTATTTGATC GTCTCAATAA
CGCATGCCCG GTTTTGGAAA ATCTGGTACT AAAAGAGTGT TTAATGGAGG TGCAACACAT TTCTTCAAGT TCACTACAAA
ATTTGGATTT GATCGGTTGC TCTCTTCTCT ATAATGTAAG CATCTGTACT CCGAGTTTGG TCTCGTTGTG CATCAAGGGT
CAACAAACGG GCAGTTTTTC ATTTACAAAC TCTTACCTGA CATTCACAAC AATCACTCTC GTTGATGCTT CAGATGTCAC
AAGCATAGAG TTGACAGCTA CTGATAGACA GGTATCACTA ATCCCTTTTT GCAGACATTT TATTACTTCC ATAAACATCA
TACAATTTTT ATGTGACCAT ACTTACGTGA ATGAAATTGC TATATTATTT AGAAaataat atagtgagta tttatttcat
agcaaggaaa gcatgaaaca ttcattttgg attatATGCA TATACCATTT TGGCTTATCA AAAATGGTAT ATAGCACTTT
GCCTTTTCAA AAAAATGTAT ATACCACTTT GCCTTTTCAA AAACATATGT ATATACCACT TTGCGTTTTC AAAAAATTGT
ATGTACCACT TTTCCTTTTT AAAAAATGTA TATACCACTT TTAACCTCGA CACATATTTG TGTAGTGTTG TATATAATAA
TATAAACCGA GGAGGAGAAA TAATCTCTTT ATTATCACCG TTTTGCCACA AATTATTGGT ATTCATAGCA TACTTGTAAT
TTTTTGCTTT GCACATATGA AGTTTACATT CATGGAACAA CAAGGAAGTA GGCCGATGTT TAGGAATCTC AGAACCTTGC
GCTTGGGTGA ATGGTGCATG GCCGATAATT TCTTGCCTCT ACGCCAATAT GTCAACCACT CACCTGTTCT GAGGAAGGTG
TTTCTGAAGC TCAGTCTGGT CAGTACCATT GATTGCATGA TCCATGTGCT ATCAACTCTG GAAACTTGAA ATCCTATTAA
CATTGTGAAT CTTTCAACTT CAGGTGGATT GGTGGTCCGA ACTCACGACC AATCAGTTGA TGGCATTAGT CGAAATTAGC
AGTGGAGGTT CCGTCAGTAT TGACTTCTAC TAG

Locus: Os08g0377100

Loading...

Locus: Os08g0377100

Loading...