Os08t0377200-01

Locus

Os08g0377200

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR12, OsRR12, Rra11, OsRR8, OsRRA11

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 12, A-TYPE response regulator 12, A-type RR 11

CGSNL Gene Symbol

RR12

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 12

Oryzabase Gene Symbol Synonym(s)

OsRR12, Rra11, OsRR8, RR8, OsRRA11

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 12, A-type RR 11

Transcript Evidence

AB249664 (Genbank)

BR000319 (Genbank)

Protein Evidence

Q2HWG1 (UniProt)

Literature

PMID: 16919402

PMID: 17293362

Note

Manual Curation

May 11, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Expression Databases

TENOR (Os08t0377200-01)

Others

Oryzabase (8157)

Transcript

366 bp

>Os08t0377200-01 A-type response regulator, Cytokinin signaling
ATGTCATCCCCCCATGTGCTTGTTGTGGATGATACCCTTGTTGATCGCCATGTTGTTTCC
ATGGCCTTAATGCGCCATAACGTCCGAGTGACTGCAGTAGAAAGTGTCATGCAAGCATTG
ATGTTTTTGGATTCGGAACATGATGTGAACATGATTGTTAGCGATTACTGTATGCCAGAC
ATGACCGGCTATGACTTACTCATGGAAGTGAAGAAATCACCTAAACTAGCACATCTCCCA
GTGGTAATTGCTTCCTCTGATAACATCCCAGAAAGGATTAGAAAGTGCTTGGATGGAGGA
GCAAAGGATTATATTCTGAAGCCAGTCAAGATTGTTGATCTGCCTCGTATTCTGAACTAC
ATATGA

CDS

366 bp

>Os08t0377200-01 A-type response regulator, Cytokinin signaling
ATGTCATCCCCCCATGTGCTTGTTGTGGATGATACCCTTGTTGATCGCCATGTTGTTTCC
ATGGCCTTAATGCGCCATAACGTCCGAGTGACTGCAGTAGAAAGTGTCATGCAAGCATTG
ATGTTTTTGGATTCGGAACATGATGTGAACATGATTGTTAGCGATTACTGTATGCCAGAC
ATGACCGGCTATGACTTACTCATGGAAGTGAAGAAATCACCTAAACTAGCACATCTCCCA
GTGGTAATTGCTTCCTCTGATAACATCCCAGAAAGGATTAGAAAGTGCTTGGATGGAGGA
GCAAAGGATTATATTCTGAAGCCAGTCAAGATTGTTGATCTGCCTCGTATTCTGAACTAC
ATATGA

Protein

122 aa

>Os08t0377200-01 A-type response regulator, Cytokinin signaling
MSSPHVLVVDDTLVDRHVVSMALMRHNVRVTAVESVMQALMFLDSEHDVNMIVSDYCMPD
MTGYDLLMEVKKSPKLAHLPVVIASSDNIPERIRKCLDGGAKDYILKPVKIVDLPRILNY
I*

CDS

chr08:17714143..17714230 (+ strand) : 88 bp

chr08:17714353..17714399 (+ strand) : 47 bp

chr08:17714485..17714562 (+ strand) : 78 bp

chr08:17714677..17714747 (+ strand) : 71 bp

chr08:17714857..17714938 (+ strand) : 82 bp

FASTA

>Os08t0377200-01 class=Sequence position=chr08:17714143..17714938 (+ strand)
ATGTCATCCC CCCATGTGCT TGTTGTGGAT GATACCCTTG TTGATCGCCA TGTTGTTTCC ATGGCCTTAA TGCGCCATAA
CGTCCGAGGT TCTTTGTTAT GCAAGTTTCC GAGTTTTGAC TATTGTTAAC TAAGTATTTC CATGTTTGAT ATCTTCTGAC
ATTCTTTTTG ACTATTATTA ACTAAGTGTT TCCATGTTTG ATATATGCAG TGACTGCAGT AGAAAGTGTC ATGCAAGCAT
TGATGTTTTT GGATTCGGTA AATTAAAAGT TCTCTTCTTG TTTATTAGGT AATGTTATTT ACAACTGTAT AACAAACATG
TATTTATCTC TGATGGACAC AGGAACATGA TGTGAACATG ATTGTTAGCG ATTACTGTAT GCCAGACATG ACCGGCTATG
ACTTACTCAT GGAAGTGAAG GTGCGTACAA TAGTATCACG GATCGGAGTA TAGTGTTAAT CTTCATCATA TATATTTTAT
AATGTTTCTA CCAAATATTT TACATGTTCA AATTGGACTT GTTTTTACTT ATAGAAATCA CCTAAACTAG CACATCTCCC
AGTGGTAATT GCTTCCTCTG ATAACATCCC AGAAAGGATT AGAAAGTAAG TACAAACACA TATACCTTGA TTTCCTTAGT
TGATAAATTC TCAATCTGAG CAAGTGGATC CTAATATGTG CTCCATTTTC CTTCTTTTTT TTTCCTTGTT GGAGGTGCTT
GGATGGAGGA GCAAAGGATT ATATTCTGAA GCCAGTCAAG ATTGTTGATC TGCCTCGTAT TCTGAACTAC ATATGA

Locus: Os08g0377200

Loading...

Locus: Os08g0377200

Loading...