Os08t0382400-01

Locus

Os08g0382400

Description

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP38

CGSNL Gene Name

CYCLOPHILIN 38

Oryzabase Gene Symbol Synonym(s)

OsCYP38, OsCYP38a, OsCYP38b

Oryzabase Gene Name Synonym(s)

cyclophilin 38

Transcript Evidence

AK099874 (DDBJ, Best hit)

Protein Evidence

NP_001151852.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

PsbQ-like domain (IPR023222)

Full-length cDNA

J013111G22 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0382400-01)

RiceXPro (AK099874)

Others

Oryzabase (10069)

KEGG (Os08t0382400-01)

Transcript

1520 bp

>Os08t0382400-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
TTTCCCACCTCCACCTCCACCTCCCCCTTCCCTTCTCGCCAATCTCACTTCATCCTCCTC
CTCCCATCAATGGCGGCGGCGCTCGCGTTCCCCACCTGCTGCTGCTGCCGCCGCCCCTCG
CTGCGTCCTTCCGCGGGTCGCCGCGGCCGTCGCCCCGTCGCCCGCTGCGCGCTCCCCTCC
TCCGAGAATTCATTTAGCTGGAAAGAATATGCAATTTCTGTAGCATTATCGGCTGGATTA
ATCACTGGCGCACCAACGTTAGGATGGCCAGCACATGCTTCTCCTCTTGAACCAGTGATC
CCAGATGTTTCAGTTTTGATCTCTGGACCTCCCATTAAAGATCCTGGTGCTTTATTGAGA
TATGCTTTGCCAATAGATAATAAAGCTGTTCGTGAAGTTCAAAAACCACTAGAGGATATC
ACTGACAGTCTTAAGATTGCTGGTGTTAGAGCCTTGGATTCAGTTGAAAGAAATGTAAGA
CAAGCATCGAGGGCACTGAGTAATGGGAGGAACCTAATTCTTGGCGGTCTTGCTGAATCC
AAAAGAGCAAATGGGGAGGAATTATTGGATAAATTGGCTGTTGGACTTGATGAGCTTCAA
CGGATTGTTGAGGACAGAAACAGGGATGCAGTAGCTCCAAAGCAGAAAGAACTTCTCCAG
TATGTTGGAACTGTAGAAGAAGATATGGTCGATGGATTCCCCTATGAAGTGCCAGAAGAA
TACAGCAGCATGCCTCTTCTCAAAGGAAGGGCTACCGTGGACATGAAGGTTAAGATTAAG
GACAATCCTAATTTAGAGGATTGCGTATTTCGGATTGTTCTGGATGGATACAATGCTCCT
GTGACTGCTGGGAACTTCTTAGATCTGGTGGAACGGAAGTTCTATGATGGCATGGAAATT
CAAAGAGCTGATGGTTTTGTTGTTCAAACTGGCGATCCTGAGGGACCAGCTGAGGGATTT
ATTGATCCCAGTACTGGTAAAGTTCGTACAATACCTCTTGAGTTAATGGTCGATGGTGAC
AAAGCGCCTGTATATGGTGAAACACTTGAAGAACTTGGCCGCTACAAGGCTCAAACAAAG
CTTCCTTTTAATGCATTTGGAACAATGGCAATGGCTAGAGATGAATTTGATGACAATTCT
GCTTCTAGCCAAATCTTTTGGTTGTTAAAAGAGAGTGAGCTAACACCAAGCAATGCCAAT
ATACTGGATGGGCGGTATGCCGTATTTGGATATGTCACCGAGAACGAGGACTACTTGGCA
GACCTCAAGGTTGGGGATGTCATTGAATCGATTCAAGTTGTCTCAGGCTTAGACAACCTC
GCCAACCCAAGCTATAAGATTGTAGGATAAAATGTTTCTTTTTTTCAGGAGTTCCTTGAT
AGGCAATTATTTTACCATATTGAAATCAGTGTAAAGTGCTATAATCTCTAACCCTCATCT
CATGACCTTCTATGTTTTGTGAGTTTTGCAATATGCGGGATTCAATATTACTTGAAAGTA
AAGACGTTCATCATTTGTCT

CDS

1281 bp

>Os08t0382400-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
ATGGCGGCGGCGCTCGCGTTCCCCACCTGCTGCTGCTGCCGCCGCCCCTCGCTGCGTCCT
TCCGCGGGTCGCCGCGGCCGTCGCCCCGTCGCCCGCTGCGCGCTCCCCTCCTCCGAGAAT
TCATTTAGCTGGAAAGAATATGCAATTTCTGTAGCATTATCGGCTGGATTAATCACTGGC
GCACCAACGTTAGGATGGCCAGCACATGCTTCTCCTCTTGAACCAGTGATCCCAGATGTT
TCAGTTTTGATCTCTGGACCTCCCATTAAAGATCCTGGTGCTTTATTGAGATATGCTTTG
CCAATAGATAATAAAGCTGTTCGTGAAGTTCAAAAACCACTAGAGGATATCACTGACAGT
CTTAAGATTGCTGGTGTTAGAGCCTTGGATTCAGTTGAAAGAAATGTAAGACAAGCATCG
AGGGCACTGAGTAATGGGAGGAACCTAATTCTTGGCGGTCTTGCTGAATCCAAAAGAGCA
AATGGGGAGGAATTATTGGATAAATTGGCTGTTGGACTTGATGAGCTTCAACGGATTGTT
GAGGACAGAAACAGGGATGCAGTAGCTCCAAAGCAGAAAGAACTTCTCCAGTATGTTGGA
ACTGTAGAAGAAGATATGGTCGATGGATTCCCCTATGAAGTGCCAGAAGAATACAGCAGC
ATGCCTCTTCTCAAAGGAAGGGCTACCGTGGACATGAAGGTTAAGATTAAGGACAATCCT
AATTTAGAGGATTGCGTATTTCGGATTGTTCTGGATGGATACAATGCTCCTGTGACTGCT
GGGAACTTCTTAGATCTGGTGGAACGGAAGTTCTATGATGGCATGGAAATTCAAAGAGCT
GATGGTTTTGTTGTTCAAACTGGCGATCCTGAGGGACCAGCTGAGGGATTTATTGATCCC
AGTACTGGTAAAGTTCGTACAATACCTCTTGAGTTAATGGTCGATGGTGACAAAGCGCCT
GTATATGGTGAAACACTTGAAGAACTTGGCCGCTACAAGGCTCAAACAAAGCTTCCTTTT
AATGCATTTGGAACAATGGCAATGGCTAGAGATGAATTTGATGACAATTCTGCTTCTAGC
CAAATCTTTTGGTTGTTAAAAGAGAGTGAGCTAACACCAAGCAATGCCAATATACTGGAT
GGGCGGTATGCCGTATTTGGATATGTCACCGAGAACGAGGACTACTTGGCAGACCTCAAG
GTTGGGGATGTCATTGAATCGATTCAAGTTGTCTCAGGCTTAGACAACCTCGCCAACCCA
AGCTATAAGATTGTAGGATAA

Protein

427 aa

>Os08t0382400-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
MAAALAFPTCCCCRRPSLRPSAGRRGRRPVARCALPSSENSFSWKEYAISVALSAGLITG
APTLGWPAHASPLEPVIPDVSVLISGPPIKDPGALLRYALPIDNKAVREVQKPLEDITDS
LKIAGVRALDSVERNVRQASRALSNGRNLILGGLAESKRANGEELLDKLAVGLDELQRIV
EDRNRDAVAPKQKELLQYVGTVEEDMVDGFPYEVPEEYSSMPLLKGRATVDMKVKIKDNP
NLEDCVFRIVLDGYNAPVTAGNFLDLVERKFYDGMEIQRADGFVVQTGDPEGPAEGFIDP
STGKVRTIPLELMVDGDKAPVYGETLEELGRYKAQTKLPFNAFGTMAMARDEFDDNSASS
QIFWLLKESELTPSNANILDGRYAVFGYVTENEDYLADLKVGDVIESIQVVSGLDNLANP
SYKIVG*

5'UTR

chr08:18020081..18020149 (+ strand) : 69 bp

CDS

chr08:18020150..18020266 (+ strand) : 117 bp

chr08:18021346..18021630 (+ strand) : 285 bp

chr08:18021792..18021991 (+ strand) : 200 bp

chr08:18022554..18022789 (+ strand) : 236 bp

chr08:18023050..18023192 (+ strand) : 143 bp

chr08:18023300..18023371 (+ strand) : 72 bp

chr08:18023472..18023699 (+ strand) : 228 bp

3'UTR

chr08:18023700..18023869 (+ strand) : 170 bp

FASTA

>Os08t0382400-01 class=Sequence position=chr08:18020081..18023869 (+ strand)
TTTCCCACCT CCACCTCCAC CTCCCCCTTC CCTTCTCGCC AATCTCACTT CATCCTCCTC CTCCCATCAA TGGCGGCGGC
GCTCGCGTTC CCCACCTGCT GCTGCTGCCG CCGCCCCTCG CTGCGTCCTT CCGCGGGTCG CCGCGGCCGT CGCCCCGTCG
CCCGCTGCGC GCTCCCCTCC TCCGAGGTGA GCGAAGCTTC TTGCGATTCT TTCCTTTTAG TTGCGCGAGC GGGATGGCTT
GGGTGCCTGC ATTGGTGGGA GCCGGATGGA TGGGTTTGGG GTGGATTTCT GGTGCGCGGC AATGTGGGTC AATCGGTGTG
GTTGGTGGGA ATCGAATTAG AATTATCCTA CCTGCGTTGT ACTATATACG AGTATTGCGG TATCTCTGTG GTGGAGGGGG
CTTGTTTACT TTACTGCCAG GGGTACAAGT ATTCAGATGT TAATGCACAC ATGATTAATA ACCTAATGGC CTGAGAGCAA
TGTATTGTGG TTCTTGCAAG ATTTTAGTTT GTTCATGTGG GGACGCTTCT GCGTTGCCAT AAGTTTTCAG CTCCCAGTCA
GCGTGAGACT GACTGACAAG GTTTGAGATT TTCCTCTATG TAAAGTTCTG CATGTGCGTT TGCTTAGTGT TGCGAGTTGA
AAATTGGGTG AAAACAGTAT TATAGACATG ATACGTAGTA AAACTGTTAG ATGATGCAGA GTTTTATAGC TGCAAATTTG
GAAAGTGAAT TGTTGTGTGT CCAAACTCCA AAGGATTgaa gtgcgaaaca ttgaatttta ttaagtaact acgatatttt
tctttcataa ttgcagctaa acctttttct tttgcgaaag attagatTTA GTTGGCAAAC TTTCCTATGC TTGTTCTTGG
TTGTAGCAAA TACGGAACCA TCCAGGCATC CAGTAAGATT GGTAATTCTG TTTCCATAAG CTATTCTTAC TGACTGCTGT
TGTCCTGCAT GTTTCATGTG CGACCTAAGC TTAGGAAGGT AAAAAATTTG TTGATGGTAT GCAGCTTGTG CTATTATACG
AATGAAAATA TTTTCTCCTT TGCATTCATA ATCATGTGTA AAAGTTGGCT ATGTTCCTTT CGTTCAAATA GTTGCATTTA
TTTTCTGTTC TGCCCTTGTA AAACAACAAT TTCCTTCATT ATCGGTACGG ATAAAGTTTC ATACTGTGAT ACCTCTAGTC
AGATGGTTTG GTTCTCTTTT ACTTTGTTAA TTTATTCTAA TTTTTTAATT CAATTCTTGC AGAAGAATTC ATTTAGCTGG
AAAGAATATG CAATTTCTGT AGCATTATCG GCTGGATTAA TCACTGGCGC ACCAACGTTA GGATGGCCAG CACATGCTTC
TCCTCTTGAA CCAGTGATCC CAGATGTTTC AGTTTTGATC TCTGGACCTC CCATTAAAGA TCCTGGTGCT TTATTGAGAT
ATGCTTTGCC AATAGATAAT AAAGCTGTTC GTGAAGTTCA AAAACCACTA GAGGATATCA CTGACAGTCT TAAGATTGCT
GGTGTTAGAG CCTTGGATTC AGTTGAAAGA GTAAGTCATC CTTTTGAGCT GCCGATTAGA AATGGTCTAG GTTTTATCTA
GAGGACAATG CATTCAATAA CTGAAAGCAG CCACCTTTTA TTTCAACTCT CTTGAATTTA CTTACTCACT TGGGCTACTG
GAAATTTATA ATTTTTTTCT TCAAATTTTA GAATGTAAGA CAAGCATCGA GGGCACTGAG TAATGGGAGG AACCTAATTC
TTGGCGGTCT TGCTGAATCC AAAAGAGCAA ATGGGGAGGA ATTATTGGAT AAATTGGCTG TTGGACTTGA TGAGCTTCAA
CGGATTGTTG AGGACAGAAA CAGGGATGCA GTAGCTCCAA AGCAGAAAGA ACTTCTCCAG TATGTTGGAA CGTGAGTGAA
CATAACTCCT CAAAACAATT ATATGTAATT GTTTGTCTTT CCATTGCTAA TGTATGGAGT AGTAGATGTT CTGACCACAG
GAGGCTGATA GATACAACAA TCCTATTGCC TGACTTGTTT TAAGAGAAAA GGCAAACTAG ATGTTTTCCC ACCTGCCATT
CTGGGGATCA AACCCGGGTG GTGCATTTCA GCCCCACACC TTCACTACTG GGGACATTGA CAAATTGTTA TGGTTTGCTG
AACAAAAGTT CTTGTGAAGT GATAACTCTT TAGTGCTACA GAACTGAATT ATGTCAGCCA CTAAATAAAA TAATTGTGAT
CACTCTTACG GAAAGGCTCT TCTCGTACTT TCACCACTGA GGACATTGAC AAAATGTTCT GGTTTGCTGA ACAAAAGTTC
TTGCAAAGTG ATAACTCTTT AGTGCTAGAG AACTGAATTA TGTTAGCCAC TAAATAAAAT AACTGTGAGC ACTCTTATGG
AAGGGCTCTT CTCATTTATA CCTTGTCATT GACTCTGCAG CTGAGATCTT CCTGGGACAT TGCATTTCTG CAGTGTAGAA
GAAGATATGG TCGATGGATT CCCCTATGAA GTGCCAGAAG AATACAGCAG CATGCCTCTT CTCAAAGGAA GGGCTACCGT
GGACATGAAG GTTAAGATTA AGGACAATCC TAATTTAGAG GATTGCGTAT TTCGGATTGT TCTGGATGGA TACAATGCTC
CTGTGACTGC TGGGAACTTC TTAGATCTGG TGGAACGGAA GTTCTATGAT GGCATGGAAA TTCAAAGAGG TAAGGTTGCT
TCTGTGATAC ATTCCATAGA TATAGTCCAA CATTGTTTAT ACCAATCACC ATTTTTAATT GCATTTTGAT AAACATGTAG
TAGATAATCT TGATAGTAAC TAGCAAGCTC GTTTTACTGA CTAAGCCATG GCATTACCCA TTTTTTCAAT GAAGAAGCCT
CTCTAGTTGT TCTCTGTTAT TTAGGATTGA GAAGTCAGAA CCTTAATTAT CTAGTGAGCT TTTGTTAACT ATTATCGGTT
CTTTTGCAGC TGATGGTTTT GTTGTTCAAA CTGGCGATCC TGAGGGACCA GCTGAGGGAT TTATTGATCC CAGTACTGGT
AAAGTTCGTA CAATACCTCT TGAGTTAATG GTCGATGGTG ACAAAGCGCC TGTATATGGT GAAACACTTG AAGTAAGTAG
GCACAGTTCT TTCTTTTTTC AGTTTCAGAA TCTACCGGAA ATTTTGGCAA CTGTATGTTG ATGAGCTTGT TCTTACAGTA
CACATGATCA TGCATTCAGG AACTTGGCCG CTACAAGGCT CAAACAAAGC TTCCTTTTAA TGCATTTGGA ACAATGGCAA
TGGCTAGAGA TGTAAGTATC ATGATACTGC TTCAGTGTAA TGTATCAAGC ATCTGCAGAT ATGGGCATGC TTCAGCATTT
TCTAACATTA AACGTTTGAA TATCATGGCA GGAATTTGAT GACAATTCTG CTTCTAGCCA AATCTTTTGG TTGTTAAAAG
AGAGTGAGCT AACACCAAGC AATGCCAATA TACTGGATGG GCGGTATGCC GTATTTGGAT ATGTCACCGA GAACGAGGAC
TACTTGGCAG ACCTCAAGGT TGGGGATGTC ATTGAATCGA TTCAAGTTGT CTCAGGCTTA GACAACCTCG CCAACCCAAG
CTATAAGATT GTAGGATAAA ATGTTTCTTT TTTTCAGGAG TTCCTTGATA GGCAATTATT TTACCATATT GAAATCAGTG
TAAAGTGCTA TAATCTCTAA CCCTCATCTC ATGACCTTCT ATGTTTTGTG AGTTTTGCAA TATGCGGGAT TCAATATTAC
TTGAAAGTAA AGACGTTCAT CATTTGTCT

Locus: Os08g0382400

Loading...

Locus: Os08g0382400

Loading...