Os08t0382400-02

Locus

Os08g0382400

Description

Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP38

CGSNL Gene Name

CYCLOPHILIN 38

Oryzabase Gene Symbol Synonym(s)

OsCYP38, OsCYP38a, OsCYP38b

Oryzabase Gene Name Synonym(s)

cyclophilin 38

Transcript Evidence

AK058264 (DDBJ, Best hit)

Protein Evidence

A6MZC4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

001-013-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0382400-02)

RiceXPro (AK058264)

Others

Oryzabase (10069)

KEGG (Os08t0382400-02)

Transcript

434 bp

>Os08t0382400-02 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
GATGACAATTCTGCTTCTAGCCAAATCTTTTGGTTGTTAAAAGAGAGTGAGCTAACACCA
AGCAATGCCAATATACTGGATGGGCGGTATGCCGTATTTGGATATGTCACCGAGAACGAG
GACTACTTGGCAGACCTCAAGGTTGGGGATGTCATTGAATCGATTCAAGTTGTCTCAGGC
TTAGACAACCTCGCCAACCCAAGCTATAAGATTGTAGGATAAAATGTTTCTTTTTTTCAG
GAGTTCCTTGATAGGCAATTATTTTACCATATTGAAATCAGTGTAAAGTGCTATAATCTC
TAACCCTCATCTCATGACCTTCTATGTTTTGTGAGTTTTGCAATATGCGGGATTCAATAT
TACTTGAAAGTAAAGACGTTCATCATTTGTCTCTTGCCATATGACCTAAAACTGAATATC
AACCGTTTTGTCTG

CDS

222 bp

>Os08t0382400-02 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
GATGACAATTCTGCTTCTAGCCAAATCTTTTGGTTGTTAAAAGAGAGTGAGCTAACACCA
AGCAATGCCAATATACTGGATGGGCGGTATGCCGTATTTGGATATGTCACCGAGAACGAG
GACTACTTGGCAGACCTCAAGGTTGGGGATGTCATTGAATCGATTCAAGTTGTCTCAGGC
TTAGACAACCTCGCCAACCCAAGCTATAAGATTGTAGGATAA

Protein

74 aa

>Os08t0382400-02 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
DDNSASSQIFWLLKESELTPSNANILDGRYAVFGYVTENEDYLADLKVGDVIESIQVVSG
LDNLANPSYKIVG*

CDS

chr08:18023478..18023699 (+ strand) : 222 bp

3'UTR

chr08:18023700..18023911 (+ strand) : 212 bp

FASTA

>Os08t0382400-02 class=Sequence position=chr08:18023478..18023911 (+ strand)
GATGACAATT CTGCTTCTAG CCAAATCTTT TGGTTGTTAA AAGAGAGTGA GCTAACACCA AGCAATGCCA ATATACTGGA
TGGGCGGTAT GCCGTATTTG GATATGTCAC CGAGAACGAG GACTACTTGG CAGACCTCAA GGTTGGGGAT GTCATTGAAT
CGATTCAAGT TGTCTCAGGC TTAGACAACC TCGCCAACCC AAGCTATAAG ATTGTAGGAT AAAATGTTTC TTTTTTTCAG
GAGTTCCTTG ATAGGCAATT ATTTTACCAT ATTGAAATCA GTGTAAAGTG CTATAATCTC TAACCCTCAT CTCATGACCT
TCTATGTTTT GTGAGTTTTG CAATATGCGG GATTCAATAT TACTTGAAAG TAAAGACGTT CATCATTTGT CTCTTGCCAT
ATGACCTAAA ACTGAATATC AACCGTTTTG TCTG

Locus: Os08g0382400

Loading...

Locus: Os08g0382400

Loading...