Os08t0382400-03

Locus

Os08g0382400

Description

Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP38

CGSNL Gene Name

CYCLOPHILIN 38

Oryzabase Gene Symbol Synonym(s)

OsCYP38, OsCYP38a, OsCYP38b

Oryzabase Gene Name Synonym(s)

cyclophilin 38

Transcript Evidence

AK060624 (DDBJ, Best hit)

Protein Evidence

A6MZC4 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-026-G03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0382400-03)

RiceXPro (AK060624)

Others

Oryzabase (10069)

KEGG (Os08t0382400-03)

Transcript

286 bp

>Os08t0382400-03 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
TGGATATGTCACCGAGAACGAGGACTACTTGGCAGACCTCAAGGTTGGGGATGTCATTGA
ATCGATTCAAGTTGTCTCAGGCTTAGACAACCTCGCCAACCCAAGCTATAAGATTGTAGG
ATAAAATGTTTCTTTTTTTCAGGAGTTCCTTGATAGGCAATTATTTTACCATATTGAAAT
CAGTGTAAAGTGCTATAATCTCTAACCCTCATCTCATGACCTTCTATGTTTTGTGAGTTT
TGCAATATGCGGGATTCAATATTACTTGAAAGTAAAGACGTTCATC

CDS

123 bp

>Os08t0382400-03 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
GGATATGTCACCGAGAACGAGGACTACTTGGCAGACCTCAAGGTTGGGGATGTCATTGAA
TCGATTCAAGTTGTCTCAGGCTTAGACAACCTCGCCAACCCAAGCTATAAGATTGTAGGA
TAA

Protein

41 aa

>Os08t0382400-03 Similar to Peptidyl-prolyl cis-trans isomerase (Fragment).
GYVTENEDYLADLKVGDVIESIQVVSGLDNLANPSYKIVG*

5'UTR

chr08:18023576..18023576 (+ strand) : 1 bp

CDS

chr08:18023577..18023699 (+ strand) : 123 bp

3'UTR

chr08:18023700..18023861 (+ strand) : 162 bp

FASTA

>Os08t0382400-03 class=Sequence position=chr08:18023576..18023861 (+ strand)
TGGATATGTC ACCGAGAACG AGGACTACTT GGCAGACCTC AAGGTTGGGG ATGTCATTGA ATCGATTCAA GTTGTCTCAG
GCTTAGACAA CCTCGCCAAC CCAAGCTATA AGATTGTAGG ATAAAATGTT TCTTTTTTTC AGGAGTTCCT TGATAGGCAA
TTATTTTACC ATATTGAAAT CAGTGTAAAG TGCTATAATC TCTAACCCTC ATCTCATGAC CTTCTATGTT TTGTGAGTTT
TGCAATATGC GGGATTCAAT ATTACTTGAA AGTAAAGACG TTCATC

Locus: Os08g0382400

Loading...

Locus: Os08g0382400

Loading...