Os08t0384500-01

Locus

Os08g0384500

Description

ABC transporter-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR17

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 17

Oryzabase Gene Symbol Synonym(s)

OsABCG44, OsPDR17

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 44, pleiotropic drug resistance 17

Transcript Evidence

AK100858 (DDBJ, Best hit)

Protein Evidence

Q6YW62 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Full-length cDNA

J023123M02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0384500-01)

Others

Oryzabase (12017)

Transcript

2536 bp

>Os08t0384500-01 ABC transporter-like domain containing protein.
GTGCTCCTTGTGCTCAGTGGATTTATCCTATCACACCATGATGTGAAAAAATGGTGGATC
TGGGGCTACTGGATCTCACCTCTCCAGTATGCGATGAACGCCATCGCAGTGAATGAGTTC
CTTGGACACAAGTGGAACCGCCTTGTCCAAGGGACCAATACAACTTTAGGAATTGAAGTG
CTCAAGTCCAGGGGGATGTTCACTGAGGCAAAATGGTACTGGATTGGCGTCGGTGCACTC
TTCGGATACGTCATTGTGTTCAACATCCTATTCACCATCGCTCTAGGCTACCTTAAACCA
TCGGGAAAAGCTCAGCAAATTCTTTCAGAGGAAGCACTGAAGGAAAAGCACGCCAATATC
ACCGGAGAAACGATCAATGATCCAAGAAACTCTGCATCTTCAGGACAAACTACCAACACA
AGGAGAAATGCTGCACCAGGTGAGGCAAGCGAGAACAGGAGAGGAATGGTGCTCCCTTTC
GCGCCGCTTGCTGTTGCCTTCAACAACATCAGATACTCTGTCGACATGCCTCCGGAAATG
AAAGCACAGGGTGTGGATCAAGACAGGCTGCTTCTGCTGAAGGGAGTCAGTGGCAGCTTC
AGGCCTGGGGTCCTCACTGCACTGATGGGAGTCAGTGGTGCTGGCAAGACAACACTGATG
GATGTGTTGGCCGGCAGGAAGACGGGAGGCTACATCGAAGGTGACATCTCGATCTCTGGC
TACCCGAAGAAGCAGGAAACCTTCGCTCGGGTCTCTGGTTACTGTGAACAGAATGACATC
CACTCGCCAAATGTGACTGTTTATGAGTCCCTGGCTTACTCTGCTTGGCTCAGGCTGCCC
TCTGATGTTGATTCAGAAACAAGAAAGATGTTTATAGAGCAAGTGATGGAGCTGGTAGAG
CTGAATCCACTGAGGGATGCGCTTGTTGGGCTACCTGGAGTAAATGGCCTGTCAACCGAG
CAAAGAAAGAGGCTGACGATCGCTGTTGAGCTCGTCGCAAATCCTTCGATAATATTCATG
GATGAGCCTACATCTGGCCTTGATGCAAGGGCGGCAGCAATTGTCATGAGGACGGTGAGG
AACACCGTTGACACAGGCAGGACTGTTGTCTGCACCATCCACCAGCCTAGCATTGACATT
TTTGAGGCCTTCGATGAGCTGTTCCTGATGAAAAGAGGTGGAGAGGAGATATACGTGGGT
CCTCTAGGACACCATTCTTGTGACCTTATTGAATACTTTGAGGGAGTCGAAGGGGTCAGC
AAGATCAAACCAGGCTACAACCCGGCAACATGGATGCTGGAAGTAACCACACTGGCACAG
GAAGACGTACTGGGGATCAGCTTTACAGATGTCTACAAGAACTCAGATCTCTACCAGAGA
AACCAGAGCTTGATCAAGGGCATCAGCAGGCCACCACAGGGGTCCAAGGACCTCTTCTTC
CCAACACAATTCTCCCAGAGCTTCTCCACCCAGTGCATGGCCTGCCTCTGGAAGCAGAAC
CTCTCCTACTGGAGGAACCCTCCCTACACCGTCGTCCGCTTCTTCTTCTCCCTCATCGTC
GCCCTCATGTTCGGCACCATTTTCTGGCGCCTCGGCAGCAAAAGATCGAGGCAGCAAGAC
CTGTTCAATGCCATGGGGTCGATGTACGCGGCGGTGCTGTTCATGGGGATCTCCTACTCG
TCGTCGGTGCAGCCGGTCGTCGCCGTCGAGCGGACGGTGTTCTACCGGGAGAGGGCCGCC
GGGATGTACTCTGCATTGCCATACGCCTTCGGACAGGTGGTGGTGGAGCTGCCGTACGTG
CTGGTGCAGTCGGCGGTGTACGGGGTGATCGTGTACGCCATGATCGGCTTCGAGTGGGAG
GCCAAGAAGTTCTTCTGGTACCTCTACTTCATGTACTTCACGCTGCTCTACTTCACCTTC
TACGGCATGCTCGCCGTCGGCCTCACCCCGAGCTACAACATCGCCTCCATCGTCTCCTCC
TTCTTCTACGGCATCTGGAACCTCTTCTCCGGCTTCGTCATCCCCCGCCCGAGCATGCCG
GTGTGGTGGAGGTGGTACTCGTGGGCGTGCCCGGTGTCGTGGACGCTGTACGGGCTGGTG
GCGTCGCAGTTCGGCGACCTGAAGGAGCCGCTCCGCGACACCGGCGTCCCCATTGACGTC
TTCCTTAGGGAGTACTTCGGCTTCAAGCACGACTTCCTCGGTGTCGTCGCCGTTGCTGTT
GCGGGGTTCGCCACGCTCTTCGCCGTCTCCTTCTCGCTCTCCATCAAGATGCTTAACTTC
CAGAGGAGGTGATGATCGATTTTTGCTAACTCAGACCTGATCGATTACCCACTTCCAATG
TAACAGTTTTTTTTTTCCTTTTTTTCAACTCTATTTTGGTTTTGTAACAAAATTCGTAGT
ATAGTGCAGTCAGAAATGAAGCAAACAGGAGTATATATACAAAGCTGATAGTGCAGATAA
TTTGTTTTACATGCATGAAATCTGTTAATTTTGATTCTATTTTGTACATGTAGTATTAAT
TGAAAAGAAATGAAAG

CDS

2292 bp

>Os08t0384500-01 ABC transporter-like domain containing protein.
GTGCTCCTTGTGCTCAGTGGATTTATCCTATCACACCATGATGTGAAAAAATGGTGGATC
TGGGGCTACTGGATCTCACCTCTCCAGTATGCGATGAACGCCATCGCAGTGAATGAGTTC
CTTGGACACAAGTGGAACCGCCTTGTCCAAGGGACCAATACAACTTTAGGAATTGAAGTG
CTCAAGTCCAGGGGGATGTTCACTGAGGCAAAATGGTACTGGATTGGCGTCGGTGCACTC
TTCGGATACGTCATTGTGTTCAACATCCTATTCACCATCGCTCTAGGCTACCTTAAACCA
TCGGGAAAAGCTCAGCAAATTCTTTCAGAGGAAGCACTGAAGGAAAAGCACGCCAATATC
ACCGGAGAAACGATCAATGATCCAAGAAACTCTGCATCTTCAGGACAAACTACCAACACA
AGGAGAAATGCTGCACCAGGTGAGGCAAGCGAGAACAGGAGAGGAATGGTGCTCCCTTTC
GCGCCGCTTGCTGTTGCCTTCAACAACATCAGATACTCTGTCGACATGCCTCCGGAAATG
AAAGCACAGGGTGTGGATCAAGACAGGCTGCTTCTGCTGAAGGGAGTCAGTGGCAGCTTC
AGGCCTGGGGTCCTCACTGCACTGATGGGAGTCAGTGGTGCTGGCAAGACAACACTGATG
GATGTGTTGGCCGGCAGGAAGACGGGAGGCTACATCGAAGGTGACATCTCGATCTCTGGC
TACCCGAAGAAGCAGGAAACCTTCGCTCGGGTCTCTGGTTACTGTGAACAGAATGACATC
CACTCGCCAAATGTGACTGTTTATGAGTCCCTGGCTTACTCTGCTTGGCTCAGGCTGCCC
TCTGATGTTGATTCAGAAACAAGAAAGATGTTTATAGAGCAAGTGATGGAGCTGGTAGAG
CTGAATCCACTGAGGGATGCGCTTGTTGGGCTACCTGGAGTAAATGGCCTGTCAACCGAG
CAAAGAAAGAGGCTGACGATCGCTGTTGAGCTCGTCGCAAATCCTTCGATAATATTCATG
GATGAGCCTACATCTGGCCTTGATGCAAGGGCGGCAGCAATTGTCATGAGGACGGTGAGG
AACACCGTTGACACAGGCAGGACTGTTGTCTGCACCATCCACCAGCCTAGCATTGACATT
TTTGAGGCCTTCGATGAGCTGTTCCTGATGAAAAGAGGTGGAGAGGAGATATACGTGGGT
CCTCTAGGACACCATTCTTGTGACCTTATTGAATACTTTGAGGGAGTCGAAGGGGTCAGC
AAGATCAAACCAGGCTACAACCCGGCAACATGGATGCTGGAAGTAACCACACTGGCACAG
GAAGACGTACTGGGGATCAGCTTTACAGATGTCTACAAGAACTCAGATCTCTACCAGAGA
AACCAGAGCTTGATCAAGGGCATCAGCAGGCCACCACAGGGGTCCAAGGACCTCTTCTTC
CCAACACAATTCTCCCAGAGCTTCTCCACCCAGTGCATGGCCTGCCTCTGGAAGCAGAAC
CTCTCCTACTGGAGGAACCCTCCCTACACCGTCGTCCGCTTCTTCTTCTCCCTCATCGTC
GCCCTCATGTTCGGCACCATTTTCTGGCGCCTCGGCAGCAAAAGATCGAGGCAGCAAGAC
CTGTTCAATGCCATGGGGTCGATGTACGCGGCGGTGCTGTTCATGGGGATCTCCTACTCG
TCGTCGGTGCAGCCGGTCGTCGCCGTCGAGCGGACGGTGTTCTACCGGGAGAGGGCCGCC
GGGATGTACTCTGCATTGCCATACGCCTTCGGACAGGTGGTGGTGGAGCTGCCGTACGTG
CTGGTGCAGTCGGCGGTGTACGGGGTGATCGTGTACGCCATGATCGGCTTCGAGTGGGAG
GCCAAGAAGTTCTTCTGGTACCTCTACTTCATGTACTTCACGCTGCTCTACTTCACCTTC
TACGGCATGCTCGCCGTCGGCCTCACCCCGAGCTACAACATCGCCTCCATCGTCTCCTCC
TTCTTCTACGGCATCTGGAACCTCTTCTCCGGCTTCGTCATCCCCCGCCCGAGCATGCCG
GTGTGGTGGAGGTGGTACTCGTGGGCGTGCCCGGTGTCGTGGACGCTGTACGGGCTGGTG
GCGTCGCAGTTCGGCGACCTGAAGGAGCCGCTCCGCGACACCGGCGTCCCCATTGACGTC
TTCCTTAGGGAGTACTTCGGCTTCAAGCACGACTTCCTCGGTGTCGTCGCCGTTGCTGTT
GCGGGGTTCGCCACGCTCTTCGCCGTCTCCTTCTCGCTCTCCATCAAGATGCTTAACTTC
CAGAGGAGGTGA

Protein

763 aa

>Os08t0384500-01 ABC transporter-like domain containing protein.
VLLVLSGFILSHHDVKKWWIWGYWISPLQYAMNAIAVNEFLGHKWNRLVQGTNTTLGIEV
LKSRGMFTEAKWYWIGVGALFGYVIVFNILFTIALGYLKPSGKAQQILSEEALKEKHANI
TGETINDPRNSASSGQTTNTRRNAAPGEASENRRGMVLPFAPLAVAFNNIRYSVDMPPEM
KAQGVDQDRLLLLKGVSGSFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDISISG
YPKKQETFARVSGYCEQNDIHSPNVTVYESLAYSAWLRLPSDVDSETRKMFIEQVMELVE
LNPLRDALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVR
NTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHHSCDLIEYFEGVEGVS
KIKPGYNPATWMLEVTTLAQEDVLGISFTDVYKNSDLYQRNQSLIKGISRPPQGSKDLFF
PTQFSQSFSTQCMACLWKQNLSYWRNPPYTVVRFFFSLIVALMFGTIFWRLGSKRSRQQD
LFNAMGSMYAAVLFMGISYSSSVQPVVAVERTVFYRERAAGMYSALPYAFGQVVVELPYV
LVQSAVYGVIVYAMIGFEWEAKKFFWYLYFMYFTLLYFTFYGMLAVGLTPSYNIASIVSS
FFYGIWNLFSGFVIPRPSMPVWWRWYSWACPVSWTLYGLVASQFGDLKEPLRDTGVPIDV
FLREYFGFKHDFLGVVAVAVAGFATLFAVSFSLSIKMLNFQRR*

CDS

chr08:18132683..18132719 (- strand) : 37 bp

chr08:18132489..18132592 (- strand) : 104 bp

chr08:18132252..18132408 (- strand) : 157 bp

chr08:18132067..18132171 (- strand) : 105 bp

chr08:18131861..18131991 (- strand) : 131 bp

chr08:18131223..18131555 (- strand) : 333 bp

chr08:18130852..18131142 (- strand) : 291 bp

chr08:18130666..18130749 (- strand) : 84 bp

chr08:18130400..18130533 (- strand) : 134 bp

chr08:18130065..18130292 (- strand) : 228 bp

chr08:18129801..18129972 (- strand) : 172 bp

chr08:18129457..18129711 (- strand) : 255 bp

chr08:18128802..18129062 (- strand) : 261 bp

3'UTR

chr08:18128558..18128801 (- strand) : 244 bp

FASTA

>Os08t0384500-01 class=Sequence position=chr08:18128558..18132719 (- strand)
GTGCTCCTTG TGCTCAGTGG ATTTATCCTA TCACACCGTA ATTCCTTTGA ACAAATAAAT CATTATGTTA AAATCCAAAA
TTCTGGTTGA AGAGTAGTAA CACTTATTTT TTCTTTGTTC ATGGCAGATG ATGTGAAAAA ATGGTGGATC TGGGGCTACT
GGATCTCACC TCTCCAGTAT GCGATGAACG CCATCGCAGT GAATGAGTTC CTTGGACACA AGTGGAACCG CGTATGTAGA
TTCTTCCTGT CCTCAGAACA ATTTTCATTT GCTGAATTCG TATCGTTCTG ATTGTCAAAA CAATCTTGCA GCTTGTCCAA
GGGACCAATA CAACTTTAGG AATTGAAGTG CTCAAGTCCA GGGGGATGTT CACTGAGGCA AAATGGTACT GGATTGGCGT
CGGTGCACTC TTCGGATACG TCATTGTGTT CAACATCCTA TTCACCATCG CTCTAGGCTA CCTTAAACGT AATTCTAAAA
TTCTACAACA GAATTCAAGC AGAATTTTGT TGAAGCACAT GATTCTGAAC TATATTCAAA TTATGCAGCA TCGGGAAAAG
CTCAGCAAAT TCTTTCAGAG GAAGCACTGA AGGAAAAGCA CGCCAATATC ACCGGAGAAA CGATCAATGA TCCAAGAAAC
TCTGCATCTT CAGGTAAGGT CGCATTTTGA ACATGGACAT GGCAACATGT CATTTGGTGA ATGCCATCTG AAGGGCCAAA
TTGTGCAGGA CAAACTACCA ACACAAGGAG AAATGCTGCA CCAGGTGAGG CAAGCGAGAA CAGGAGAGGA ATGGTGCTCC
CTTTCGCGCC GCTTGCTGTT GCCTTCAACA ACATCAGATA CTCTGTCGAC ATGCCTCCGG TAACATCCCt tgactatttt
actattcctc cagtattaga acctaatcag aaatttcagt ctgaacaatt gcaaaaaact atttgtttta tagttttgtt
tcatatgtat tttgtttctg atagaatgtt gtgcactgga agatgTTGAT ACAAGAGATT TGGTTGCTTT CTTTTTTGTG
CATTTTTTTT TTGATTGCTT TCAGAGTTTC AGATATCAAC ACATCATGAC CTAGTGATAA TACAACAGTT AATATCATGC
AATCATTTGA AGTTCATGAA AGAAAACATA TTGCATCATT GCAGGAAATG AAAGCACAGG GTGTGGATCA AGACAGGCTG
CTTCTGCTGA AGGGAGTCAG TGGCAGCTTC AGGCCTGGGG TCCTCACTGC ACTGATGGGA GTCAGTGGTG CTGGCAAGAC
AACACTGATG GATGTGTTGG CCGGCAGGAA GACGGGAGGC TACATCGAAG GTGACATCTC GATCTCTGGC TACCCGAAGA
AGCAGGAAAC CTTCGCTCGG GTCTCTGGTT ACTGTGAACA GAATGACATC CACTCGCCAA ATGTGACTGT TTATGAGTCC
CTGGCTTACT CTGCTTGGCT CAGGCTGCCC TCTGATGTTG ATTCAGAAAC AAGAAAGGTA CCAATTATAG TAGAAATTAA
TTGCCGAGCT AAATGCAGGA TAAAATTCTG AACATATTGC TGTTCATTTC TGAACAGATG TTTATAGAGC AAGTGATGGA
GCTGGTAGAG CTGAATCCAC TGAGGGATGC GCTTGTTGGG CTACCTGGAG TAAATGGCCT GTCAACCGAG CAAAGAAAGA
GGCTGACGAT CGCTGTTGAG CTCGTCGCAA ATCCTTCGAT AATATTCATG GATGAGCCTA CATCTGGCCT TGATGCAAGG
GCGGCAGCAA TTGTCATGAG GACGGTGAGG AACACCGTTG ACACAGGCAG GACTGTTGTC TGCACCATCC ACCAGCCTAG
CATTGACATT TTTGAGGCCT TCGATGAGGT AAGCTGCAAG TAGACTGAAT GTTCAGAACT CTGATTTTTT TTTTCTTCAT
GTTTTCGAGA GTTATCGCGG ATTGTAAAAA TACTCTTTAC TCTTGTGTAG CTGTTCCTGA TGAAAAGAGG TGGAGAGGAG
ATATACGTGG GTCCTCTAGG ACACCATTCT TGTGACCTTA TTGAATACTT TGAGGTAACT TCACTTTCTT CTCTGAAGTT
TTTTTTAATT CAACCTGACA TTTCTTTCCT TTCCCACCGT TTATGACACA CTGATCTTGT GTTGTGTGAC TGTGATTCAC
TGGATTTTTT TTCTTGTTAT TGTCAGGGAG TCGAAGGGGT CAGCAAGATC AAACCAGGCT ACAACCCGGC AACATGGATG
CTGGAAGTAA CCACACTGGC ACAGGAAGAC GTACTGGGGA TCAGCTTTAC AGATGTCTAC AAGAACTCAG ATCTCTACCA
GTAAGCCAAT GATCCATTAA TTCTTTGCTT CCTGTCTCAT AATTAACCTG CAGACACGAA GTTCTGACAA AAAGCTTGGA
TTCATATGGC ATTGTTGCCC ATTGCAGGAG AAACCAGAGC TTGATCAAGG GCATCAGCAG GCCACCACAG GGGTCCAAGG
ACCTCTTCTT CCCAACACAA TTCTCCCAGA GCTTCTCCAC CCAGTGCATG GCCTGCCTCT GGAAGCAGAA CCTCTCCTAC
TGGAGGAACC CTCCCTACAC CGTCGTCCGC TTCTTCTTCT CCCTCATCGT CGCCCTCATG TTCGGCACCA TTTTCTGGCG
CCTCGGCAGC AAAAGGTAGC ATCACCCGCA AAATCAGTCT CAACTTCTGA TCATGAATCC CAATGTCATG TTCTTGTACT
GACTGTGTTG TTTGAACATG GGTTCAGATC GAGGCAGCAA GACCTGTTCA ATGCCATGGG GTCGATGTAC GCGGCGGTGC
TGTTCATGGG GATCTCCTAC TCGTCGTCGG TGCAGCCGGT CGTCGCCGTC GAGCGGACGG TGTTCTACCG GGAGAGGGCC
GCCGGGATGT ACTCTGCATT GCCATACGCC TTCGGACAGG TAAAGAACAT TCTTGGAGGT TGGAGCTTGA GCTGAAAGCC
AGCAATGGAA GCATTTGACC GGAGATTTTT GTCGATCGAT CGGTGCAGGT GGTGGTGGAG CTGCCGTACG TGCTGGTGCA
GTCGGCGGTG TACGGGGTGA TCGTGTACGC CATGATCGGC TTCGAGTGGG AGGCCAAGAA GTTCTTCTGG TACCTCTACT
TCATGTACTT CACGCTGCTC TACTTCACCT TCTACGGCAT GCTCGCCGTC GGCCTCACCC CGAGCTACAA CATCGCCTCC
ATCGTCTCCT CCTTCTTCTA CGGCATCTGG AACCTCTTCT CCGGCTTCGT CATCCCCCGC CCGGTATGTA TCGTTAAATC
TTACTTAACC TTAAGCTTTT GGATCGAACG GGCTAGCACA CGGCATCTGA AATAGAGATG TATGCTAAGC TTCTGGGGTG
AACTGGTTGG TAGTATGGTA TACGACATCG AAAATGCCGA TGTCATTTAA GCTTTTTGGT TGAACTGGCT AGTACTAGGG
TTTTTAAACG GTTATCATAg ttatcacgtg cgttaacctt ctcagttttt gaaaccacgg tatacctcac ggtaaccgca
cgattaccac gattaccgcg gtaaccgtca aaccgtgtgg tggcggtaat cccaccccaa acggtttggt aaaccctGGT
CGATACGCGC ACGACATCTA TACGAAACTG ATGTGTTATT CTTGGTGATG TGTTCAGAGC ATGCCGGTGT GGTGGAGGTG
GTACTCGTGG GCGTGCCCGG TGTCGTGGAC GCTGTACGGG CTGGTGGCGT CGCAGTTCGG CGACCTGAAG GAGCCGCTCC
GCGACACCGG CGTCCCCATT GACGTCTTCC TTAGGGAGTA CTTCGGCTTC AAGCACGACT TCCTCGGTGT CGTCGCCGTT
GCTGTTGCGG GGTTCGCCAC GCTCTTCGCC GTCTCCTTCT CGCTCTCCAT CAAGATGCTT AACTTCCAGA GGAGGTGATG
ATCGATTTTT GCTAACTCAG ACCTGATCGA TTACCCACTT CCAATGTAAC AGTTTTTTTT TTCCTTTTTT TCAACTCTAT
TTTGGTTTTG TAACAAAATT CGTAGTATAG TGCAGTCAGA AATGAAGCAA ACAGGAGTAT ATATACAAAG CTGATAGTGC
AGATAATTTG TTTTACATGC ATGAAATCTG TTAATTTTGA TTCTATTTTG TACATGTAGT ATTAATTGAA AAGAAATGAA
AG

Locus: Os08g0384500

Loading...

Locus: Os08g0384500

Loading...