Os08t0404200-00

Locus

Os08g0404200

Description

Similar to Chloroplast 50S ribosomal protein L27 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPL27-2

CGSNL Gene Name

MITOCHONDRIAL RIBOSOMAL PROTEIN L27

Oryzabase Gene Symbol Synonym(s)

rpl27-2, rpl27, mtRPL27a, S27

Oryzabase Gene Name Synonym(s)

mitochondrial ribosomal protein L27, F1 pollen sterility gene S27

Transcript Evidence

AB496675 (DDBJ, Best hit)

Protein Evidence

B6T4C5 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: translation (GO:0006412)

Cellular Component: intracellular (GO:0005622)

Cellular Component: ribosome (GO:0005840)

Molecular Function: structural constituent of ribosome (GO:0003735)

Functional domain (InterPro)

Ribosomal protein L27 (IPR001684)

Ribosomal protein L27, conserved site (IPR018261)

Expression Databases

TENOR (Os08t0404200-00)

Others

Oryzabase (6408)

Transcript

438 bp

>Os08t0404200-00 Similar to Chloroplast 50S ribosomal protein L27 (Fragment).
ATGGCTTTTTCATCAGTTTTCAGGAGAGGAAATGTCAAAGAATTGATCTCAAATGTTTCG
GTCTACACTAGCGCAGCAGAGTCATCTGGAGGATTGAGCTTGATTTTTAAGCGTTGGGCC
ACCAAAAAGACAGCTGGATCAACAAAAAATGGCCGTGACTCTAACCCTAAGTATTTGGGT
GTTAAAAAGTTTGGCGGAGAGAAAGTGGAGCCAGGAAACATCATCATCCGCCAAAGAGGA
ACCCGCTTCCATCCTGGGAACTACGTTGGCATGGGGAAGGACCATACTCTCTTCTGTCTG
AAAGAAGGACATGTGCGATTCGAGCGCAACAAGCTGACTGGCAGGAAATGGGTTCATGTT
GATCCTGTTGCTGGGCATGTGCTCCACCCTGTCTACGCCAGTGATTCGACCCCTGCAGCT
GAAATGGAGCCATTGTAA

CDS

438 bp

>Os08t0404200-00 Similar to Chloroplast 50S ribosomal protein L27 (Fragment).
ATGGCTTTTTCATCAGTTTTCAGGAGAGGAAATGTCAAAGAATTGATCTCAAATGTTTCG
GTCTACACTAGCGCAGCAGAGTCATCTGGAGGATTGAGCTTGATTTTTAAGCGTTGGGCC
ACCAAAAAGACAGCTGGATCAACAAAAAATGGCCGTGACTCTAACCCTAAGTATTTGGGT
GTTAAAAAGTTTGGCGGAGAGAAAGTGGAGCCAGGAAACATCATCATCCGCCAAAGAGGA
ACCCGCTTCCATCCTGGGAACTACGTTGGCATGGGGAAGGACCATACTCTCTTCTGTCTG
AAAGAAGGACATGTGCGATTCGAGCGCAACAAGCTGACTGGCAGGAAATGGGTTCATGTT
GATCCTGTTGCTGGGCATGTGCTCCACCCTGTCTACGCCAGTGATTCGACCCCTGCAGCT
GAAATGGAGCCATTGTAA

Protein

146 aa

>Os08t0404200-00 Similar to Chloroplast 50S ribosomal protein L27 (Fragment).
MAFSSVFRRGNVKELISNVSVYTSAAESSGGLSLIFKRWATKKTAGSTKNGRDSNPKYLG
VKKFGGEKVEPGNIIIRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWVHV
DPVAGHVLHPVYASDSTPAAEMEPL*

CDS

chr08:19304751..19304829 (+ strand) : 79 bp

chr08:19304943..19305064 (+ strand) : 122 bp

chr08:19305291..19305527 (+ strand) : 237 bp

FASTA

>Os08t0404200-00 class=Sequence position=chr08:19304751..19305527 (+ strand)
ATGGCTTTTT CATCAGTTTT CAGGAGAGGA AATGTCAAAG AATTGATCTC AAATGTTTCG GTCTACACTA GCGCAGCAGG
TAATGGCTTT GGCTTTAGGC AGTCTGAGAC TCTTGACTGA CTTGAGTCTG TATTTGTGCT ATTTTGAATA AGGTGCTTGG
CTGTTTGAAT GACAAAATAT ACCTCATTGC AGAGTCATCT GGAGGATTGA GCTTGATTTT TAAGCGTTGG GCCACCAAAA
AGACAGCTGG ATCAACAAAA AATGGCCGTG ACTCTAACCC TAAGTATTTG GGTGTTAAAA AGTTTGGCGG AGAGGTACAA
TCTTGTGATC TGTCATATGA CTTTCATGTT TTTTTATTGT TTATGACAGC ACAAAGTACT TTCTTTAATC ACGTAAAAGT
AATCAGACTT CGGAGATTTG TGTGTCCCTT CTGATCCCGT ACCTGAACTC CTGAAGCAAC TTGTCATTTT TGTTATTAGA
ACAAAAAGGT GAAAAAGATC TAAACTGTTC CTGAACATCA GCATTTGCAT CATTTTTCAG AAAGTGGAGC CAGGAAACAT
CATCATCCGC CAAAGAGGAA CCCGCTTCCA TCCTGGGAAC TACGTTGGCA TGGGGAAGGA CCATACTCTC TTCTGTCTGA
AAGAAGGACA TGTGCGATTC GAGCGCAACA AGCTGACTGG CAGGAAATGG GTTCATGTTG ATCCTGTTGC TGGGCATGTG
CTCCACCCTG TCTACGCCAG TGATTCGACC CCTGCAGCTG AAATGGAGCC ATTGTAA