Os08t0408200-01

Locus

Os08g0408200

Description

WD40 subfamily protein, Salt stress

RAP-DB Gene Symbol Synonym(s)

SRWD4, SRWD4, OsWD40-160

RAP-DB Gene Name Synonym(s)

SALT RESPONSIVE WD40 PROTEIN 4, salt responsive WD40 protein 4

CGSNL Gene Symbol

SRWD4

CGSNL Gene Name

SALT RESPONSIVE WD40 PROTEIN 4

Oryzabase Gene Symbol Synonym(s)

SRWD4, OsWD40-160

Oryzabase Gene Name Synonym(s)

salt responsive WD40 protein 4

Transcript Evidence

AK111715 (Genbank)

Protein Evidence

Q6Z9W0 (UniProt)

Literature

PMID: 18755256

Note

Manual Curation

June 9, 2009

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

J023019D09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0408200-01)

RiceXPro (AK111715)

Others

Oryzabase (8213)

KEGG (Os08t0408200-01)

Transcript

2162 bp

>Os08t0408200-01 WD40 subfamily protein, Salt stress
TCTCCCCCTCGCCTCCGCGTCGCCGCCTTCAAAAATACTAATAAAAAAGAAAAAAAACGC
AAAAAGAAAAGGGAGGGTAGGAGAGAAAAAAAAAAAAAAGAAAAAAACTTCCCGAATTCC
CCATCCTCCTCCGCGCCGCCTCGCCGGAATTCGCCTCGAGGTCCGGCTAATCGAAGCGGC
GGTTGATTTCTAGGTCGGATCGGGGGGGCGTCGGGAGAATGGACGAGTTCGAGCTGGAGG
ATAACCTAGAGTTACTCCTCCAGAGCATCCAGGAGCTCATCGAGGACCAGGGGGAGAACA
ACCCCTTCGGCGCGGCCAACCACGACGAGCTCATCGCTAGCCTCCTCCACAACAACCAGG
AGAATCCGCTGACTGATGTGTCCGTGGAGGACGTTAGGGATGGGAAGGACATGCAGGGGA
TCCCCTGGGAGAAGATTGTGTTCCGGAGGGATCAGTATCGGGAGATGAAGATGAAGAATT
ACAGGAATTATCAGAACCTGAGTTATGCCCGGGAGGAAGCTCTGAAGGACTGCAAGAAAG
TTGAAAAGGATAGTCCTTACTACGATTTCCAGTACAATACAAGGCGTGCTCGCCCATCAA
TTGTACATTTTCAGTTAAGGAATCTGGTCTGGGCAACAACCAAGCATGATGTTTACACGG
TGCACAACCAATCAGTGACACATTGGTCATCATTGGACCAGACAAGTACTGAGCTAATCA
ATGCGGATGACTGCATTATACCAAAACAGAGAGGGCATGGTTCACAGTCCGTTGCAATGG
TCCAGGTCACAACTATGGCTGTAGATGATAGTTTATTGGTAATTGGTGGTTTTCAGGGGG
AGCTTATATGCAAGCGCCTGGAAGATGATGGAGTTCTTTTCAGCACAAGAGTTACAGATG
ATGAGAATGCTATTACCAACTCTTTGGAGATATATCAGGATCCCACTGGATCTAGACGGT
TGGTGGCTGCTAACAATGACTGCTCTGTCAGAATTTTTGACATTGAGTACTTTGATTTGC
TGAAGCACTATGTCTTCCCATGGTCTGTGAATAGCGTTTCGGTGAGCCCAAAAGGGGGAC
TGTTTGCTGTCCTTGGGGACCATGAGGATGGCTTGGTAGTGGATCCCAAGTGTGGCAAGg
caatcggtgcacttaagggtcacttggattactctttCGCATCTGCCTGGCATCCTGATG
GCAATATCTTGGCTACCGGCAGTCAAGATACAACCTGTCGGCTGTGGGACATTAGAAACC
TATCAGAGTCTGTGGCTGTACTTGGCGGAAGGATGGGCTCGATACGTTGCATCAAGTTCT
CTTCAGACGGGCGGTTCTTGGCTACTGCAGAACCTGTGGATTTCGTCCATATCTACGATT
CATATGCAGACTATGGCAGATCTCACGAGATTGACTTGTTTGGAGAGATTGCTGGATTGT
CATTCAGCCCAGACGCCGAGGCCTTGTACGTTGGCATAGCAGATCCAACATACGGTGGCC
TCATAGAGTTCAACAGGAGGCACCAACATCATTATTTGAACTGCATGTGGTGATGCCATT
TGTTAAGCGAAATGTGCGTCTTTGCTGAGCTTAGCAGTCCTCCGATTATGTGCTGCATAA
CTTGCACAACTTGTGGAAGGCGCACTAATAGTGAAAAGCTCATTAAAGAAATTTTGCTGC
TTTAGTTTTTAGCTGCAGCACCTGAAGCTCATGAATGGCCCCGAACTGTAAAATTCTGTC
CCTTTTGTCTAAAATGTCACTTAGGAACTGATGGAGGTAGATATATATGTATAGCCGTCC
TATTTCATTTTTCTCCAAATCGATGTACATATAGTTGTGGTATCCCGGTTCTTTGCAACG
CAACGAGCATTGGCAACAAAATAGCAAGGATAAATTATGCCAGAAGTGGATGGTTCGGCA
CATCCGGAAGAAGATTTTAGCTCAATGATCATATGTGTTCCACTCGGTTGTTCGGCTCTC
GTTTATACAAGAACAGGGAATTTCCCAGCAGCGACCTTTTCAGTCCTTGGGACACGTAGA
AATTGCTAGTCGGTGGCTCGGAGCCGTTCTCTCTTTATCAAACCGAACATGCTTGGAATT
CTCTATTATCATAATTTTGCAATATCCATTTATAGATATTGAAATCAAAGTACGTTACAT
CC

CDS

1335 bp

>Os08t0408200-01 WD40 subfamily protein, Salt stress
ATGGACGAGTTCGAGCTGGAGGATAACCTAGAGTTACTCCTCCAGAGCATCCAGGAGCTC
ATCGAGGACCAGGGGGAGAACAACCCCTTCGGCGCGGCCAACCACGACGAGCTCATCGCT
AGCCTCCTCCACAACAACCAGGAGAATCCGCTGACTGATGTGTCCGTGGAGGACGTTAGG
GATGGGAAGGACATGCAGGGGATCCCCTGGGAGAAGATTGTGTTCCGGAGGGATCAGTAT
CGGGAGATGAAGATGAAGAATTACAGGAATTATCAGAACCTGAGTTATGCCCGGGAGGAA
GCTCTGAAGGACTGCAAGAAAGTTGAAAAGGATAGTCCTTACTACGATTTCCAGTACAAT
ACAAGGCGTGCTCGCCCATCAATTGTACATTTTCAGTTAAGGAATCTGGTCTGGGCAACA
ACCAAGCATGATGTTTACACGGTGCACAACCAATCAGTGACACATTGGTCATCATTGGAC
CAGACAAGTACTGAGCTAATCAATGCGGATGACTGCATTATACCAAAACAGAGAGGGCAT
GGTTCACAGTCCGTTGCAATGGTCCAGGTCACAACTATGGCTGTAGATGATAGTTTATTG
GTAATTGGTGGTTTTCAGGGGGAGCTTATATGCAAGCGCCTGGAAGATGATGGAGTTCTT
TTCAGCACAAGAGTTACAGATGATGAGAATGCTATTACCAACTCTTTGGAGATATATCAG
GATCCCACTGGATCTAGACGGTTGGTGGCTGCTAACAATGACTGCTCTGTCAGAATTTTT
GACATTGAGTACTTTGATTTGCTGAAGCACTATGTCTTCCCATGGTCTGTGAATAGCGTT
TCGGTGAGCCCAAAAGGGGGACTGTTTGCTGTCCTTGGGGACCATGAGGATGGCTTGGTA
GTGGATCCCAAGTGTGGCAAGgcaatcggtgcacttaagggtcacttggattactctttC
GCATCTGCCTGGCATCCTGATGGCAATATCTTGGCTACCGGCAGTCAAGATACAACCTGT
CGGCTGTGGGACATTAGAAACCTATCAGAGTCTGTGGCTGTACTTGGCGGAAGGATGGGC
TCGATACGTTGCATCAAGTTCTCTTCAGACGGGCGGTTCTTGGCTACTGCAGAACCTGTG
GATTTCGTCCATATCTACGATTCATATGCAGACTATGGCAGATCTCACGAGATTGACTTG
TTTGGAGAGATTGCTGGATTGTCATTCAGCCCAGACGCCGAGGCCTTGTACGTTGGCATA
GCAGATCCAACATACGGTGGCCTCATAGAGTTCAACAGGAGGCACCAACATCATTATTTG
AACTGCATGTGGTGA

Protein

445 aa

>Os08t0408200-01 WD40 subfamily protein, Salt stress
MDEFELEDNLELLLQSIQELIEDQGENNPFGAANHDELIASLLHNNQENPLTDVSVEDVR
DGKDMQGIPWEKIVFRRDQYREMKMKNYRNYQNLSYAREEALKDCKKVEKDSPYYDFQYN
TRRARPSIVHFQLRNLVWATTKHDVYTVHNQSVTHWSSLDQTSTELINADDCIIPKQRGH
GSQSVAMVQVTTMAVDDSLLVIGGFQGELICKRLEDDGVLFSTRVTDDENAITNSLEIYQ
DPTGSRRLVAANNDCSVRIFDIEYFDLLKHYVFPWSVNSVSVSPKGGLFAVLGDHEDGLV
VDPKCGKAIGALKGHLDYSFASAWHPDGNILATGSQDTTCRLWDIRNLSESVAVLGGRMG
SIRCIKFSSDGRFLATAEPVDFVHIYDSYADYGRSHEIDLFGEIAGLSFSPDAEALYVGI
ADPTYGGLIEFNRRHQHHYLNCMW*

5'UTR

chr08:19522108..19522283 (+ strand) : 176 bp

chr08:19522433..19522474 (+ strand) : 42 bp

CDS

chr08:19522475..19522615 (+ strand) : 141 bp

chr08:19522730..19522897 (+ strand) : 168 bp

chr08:19526148..19526234 (+ strand) : 87 bp

chr08:19526792..19526926 (+ strand) : 135 bp

chr08:19527019..19527123 (+ strand) : 105 bp

chr08:19527209..19527300 (+ strand) : 92 bp

chr08:19527388..19527493 (+ strand) : 106 bp

chr08:19527579..19527665 (+ strand) : 87 bp

chr08:19527757..19528170 (+ strand) : 414 bp

3'UTR

chr08:19528171..19528779 (+ strand) : 609 bp

FASTA

>Os08t0408200-01 class=Sequence position=chr08:19522108..19528779 (+ strand)
TCTCCCCCTC GCCTCCGCGT CGCCGCCTTC AAAAATACTA ATAAAAAAGA AAAAAAACGC AAAAAGAAAA GGGAGGGTAG
GAGAGAAAAA AAAAAAAAAG AAAAAAACTT CCCGAATTCC CCATCCTCCT CCGCGCCGCC TCGCCGGAAT TCGCCTCGAG
GTCCGGCTAA TCGAAGGTGA GCTTTGGAGA AATTTGGTCT AGGTTTTGGG GGATTTTGGC TGCCGCTCCC GGATTCGTGG
CCCGATTTTG TGATTTTTTT TTTGTTTTGG GGGGAGTTGT TGTTAGGGCA GTTTTCGTGA TCGGTGATTT TGGTTCGGTT
TGCAGCGGCG GTTGATTTCT AGGTCGGATC GGGGGGGCGT CGGGAGAATG GACGAGTTCG AGCTGGAGGA TAACCTAGAG
TTACTCCTCC AGAGCATCCA GGAGCTCATC GAGGACCAGG GGGAGAACAA CCCCTTCGGC GCGGCCAACC ACGACGAGCT
CATCGCTAGC CTCCTCCACA ACAACCAGGT GCGACGCCGC CGCCGCCGCC AGCGCTGGTG CTTCCCAATT GCTGCGGTTG
CGGTTCCACA TGCGGTGGAA TTAAGTTTCT GTTTATTTAT TATTTTTTGT GTTGCTTTGC AGGAGAATCC GCTGACTGAT
GTGTCCGTGG AGGACGTTAG GGATGGGAAG GACATGCAGG GGATCCCCTG GGAGAAGATT GTGTTCCGGA GGGATCAGTA
TCGGGAGATG AAGATGAAGA ATTACAGGAA TTATCAGAAC CTGAGTTATG CCCGGGAGGA AGCTCTGAAG GTACCTTGTT
TATGCTCTTG GACTATCCTT TTATTATTTG TCGAATCACT TAGGCAAGCT ATGGTGTGAG GTTCATGATG ATCCATTAGG
CAATTAGAGT GTCCAACGTC TCAATCTGTG TCATCAGTTC TTGAGTTCAA AATCATGGGA ACATGATAGG CTGCATTATG
GGCATGATAG TATGGGAAAA AAAACATAAA CGGGTTGAAA TAAACATATT GTGCATGTGC TATTGTGCTA CATGCTTGTG
TATTGTGGAG ACACTTATGT GCATAAAGTC CTAAACAAAT GTTTCTATGT GGTAGTTGGA ATGCCTCAAT TGCCTACTAG
CATACTAGGC ATATAGATAC TAGTTTGTAT GAGAATTTGA TGCTTGTTAT TTATTTTCCC CCTGTAGAAT GGATGTGTGT
TACTTGGTTT AGTTTTCAGT AAATCTTAAA AAGTTGTCAA TTGGATTGCA CATAATCTAC AGTAATACAG ATAAATGCCA
ACTTTTTATT TAAATCTTGA GTATCTACTT TGTCGATCCC CCCCCCTGTT TTCGATAGTT TGTCAATATA AATGGAGGAA
TCTCATGTCA TTCTTTTTCT CCAGTAACTG CTTAGATTTT CTGAATGAGC AATCCTTATG TGTTGTTTGG CTGATCCCAT
GAAGTGCCAA GTGTTCTGTA ATGAATGATT CCAGCTATGA CTGGTTACCT CCAAACATTA ACATACACAT AAAATATACG
AGTATATACT AAATTGCTAC TGAACACCAT TAGTTACCTA CTGACCTGTT ACCACCATGC GAGTCAATCC ATTTTATGGG
CAGCTTATCC AAATGCCATG GCATACTCAA GAGTTCAGAC AGCCAATCAA ACACAACATG TAGATGATTT ATGGTGGTTT
GTGTGCTTAT GAGTTATGAG TGCTCATCCA TCATGGTGTT GATTACTTAT CCTGCATTAG CTATTTAGGG GTTTATTTGA
TTAGGTGTAC ATGTGATAGC ATGAAATCTT GTTCCCATAA TCCCATTACT TAGGGCTTCT TCTGAACGCA GGGATTTTAC
AGGAAACAGT TTAGCTCCGC CAAAATTCCC GCGAAAATCC TCCAAACAGA ATAGGCCCTT AAATTGTTTT CTTTATATGT
TTACATGGTT TTTATGTTGA TTGTGTTTAG TTGATTATAA ACCTCCTCTC AATTGTTTCT ATTGAAATTC AACCTTTTGA
AACAATTGAA ATTCAACCTT TTGTTTCACA TAGCAAATTG ATACTTACAA CCATCACTAG TTCACTTAGT CATCAGTCAT
GAATGTCATG CCTTAATATA TTTAGCATGA GCCACCCTTG GACTCGGTGT TGATAGCTGT TCATACTCAA TTAATCAATC
TCTTAAGTAT CACTTCTCAC CACTAACAAT TGATGATCAC TAGTGACGAA CAAAAGATAA CATTAAGAAT GAGCTTGTCT
TGTAACCATC TGAAAAATAT AACTCATGTA TGAAAACGTT TACCTTTTAA CATGATATAA ATGCATAAAG CATATTAAGG
TAACATTCCA AAATCCTTTC TCCATTTCCT ATCATGGGTT TTCTCAGCAC ACCAAATAGT CAAACAGTCT GTCCCTCATT
TGTCATTTGC ATCAGTGGCT GCAGGGATGA TCTTATTTAT TCAAGTGAAC TCCCTTATGC GTGGTTCATT AATATTGTAG
AGTTAGCCTT ATGAGATTCT TCATTGATGT CCAATGATCT ATGCATGGCA CATAATCAGT TGTCTGTGAT AGAGTTTGAA
AGAAATGCTG GAAGGTTTTC ACATTTTCAC ACAGATGATC TAGTAAAATT AACATTAGAA AGCAAGCATT AAGGAGAGTT
TATTTAATCT ACTCTCTTCA TTGGAGTTAA TATAGGTGTT TGATGATTCT GGTCAGGATC TTTTTCCCCT AATCCCCTAT
TATCTGCATT CTTTTCTATT ACGATGTTGG CAAATTACAT CTATTAATGT TTGTAAAGCT AGCTTGAATT AAAATTTTGG
ATGATATGCA TGGGCCATAG ATGAATCTAT AAAATCCAAT GGAATCATTA TGATCGTTGT AGTTTTGTAT CTGTATCATT
ATATGCACTT CAGATAGTTG GAGATATCCA CTTTCACATT ATTGACCTGT CATTTGTTTA GGGCAACATA TGTAAAGACA
GTATCAATTT GGGGTAGGGT AATTATTTCC TCTTATATTC ATGAAATCAG AGAAATTCTG ATAATCCTGC CACATCCCAG
AAGTTAAGTT ATTTAGGTCA ATTTGAATCA AAAGGAGTAT TTTAGAAAGA ATTGTATGCT GTTGATTTGA CTGAATGTAT
TGTACTAACT CCCACTTAAA AGTTATGTGA GCTATGGCAA TTTTAGTATT TTCTTTTTAA TCGATAAAAA AAACCTCAAA
AGATATACAT GAAGCCCAAG GTTGATCAAA CCTCCTTAAG GAAACACTGT TTAAATCTAT AGTTATATGA ACTTTTGTCA
TGTGACTCAT TTTTGTTATG TTCTCCTTGA TAAATATTGT TTAGCAACTG TTGTCTAAAG TATGATAATA GTTATGTACT
TAGAGCGTTA GACATGAAAT GAATATGCTG AAGTGTATAA AATGGGTTGC AACATTTATG ATGTTCCTGA CATGATTTTC
ACACTGTATT ATTCTTACCC GACTGAAATT ACCTAAAACC AGGATGCTTT CCTTGTGTGA ACTCAGACAA TTGATCCCTC
ACAAACAGTT GGAACAATCA TTTCTTACTT TCTGCTTAAA CTATGAACTG TTTAGCATGG AAAACAGGTG GAAATACTGT
TAAAGACTTT TTTTTTTGGT TTTGCTGCAA GTTTCTTTGC ACCTTAATGT GTAACTGTAA CTACATGCAA CTTTCTGTGG
AAACAATTAA TTCTTAGGGA CTGAGGAGGA AAGTTGTTTC TATTGTTTGC TGTTGTTTAG GGACAGGAAG ATAGCTGTGT
TTATATCCAA TTAATTTCAT ATGATATATG TAGGGAACCA ATTTTCAAAA GCCTTTGTGT AGTAGCACAC CAACCATAGG
TTGTTGCATG AGCTCATATA ATGTGTTAAC GGAACTTCTC CACAAGTCCT TAGTCTTTGT TTACTAACTT TATTGTTATG
GTTACAGTCC AGCGCCTACT GTTGGAAATT CACAGTACAG TCAAATCCTG AAAAATAATT TATATCATCA TTTGCTTGTC
AGTCAGCTTC TTAAAATCTC TTCCTGTTTA TGTTATACAG GACTGCAAGA AAGTTGAAAA GGATAGTCCT TACTACGATT
TCCAGTACAA TACAAGGCGT GCTCGCCCAT CAATTGTACA TTTTCAGGTT TGTAATCACT CTGTTGACAT TCCAATATCT
GTAGCTCAGT TATGCTACGG TTGATCTTAT TTGAACTTGA CCAGCCATGT TGTCCTTTGG TACTACTTGG TCATAGCAGT
AAATGATAAA CCTTTTCAAA ATATCTGGCT TGTAGAGATC ATATAGGTCC TAATAGGAAT TGATGGAAAA GAAGTTGCAG
GTAGTTGTTA AGAGTTACAA TATATCTGTG AAAAGTTTTA CCATCAATAT AGTGAACTCC CAATAATTAA CATTTTAATA
GTTATTTCGG CAAGTGGCAT AACTTTTGCT GAAATGACAC ACAAGACAAG ATATCGAAGG AACAACTTTA TTTTACTGTT
AAAAGATGGA TGGACTAAGT GTTGAACGTC CAACATGCTA GATGTGATAT CATTCTTCTA TACATGCATG CATCAAAATA
CATCAATTTG CTACTTTTAT GTCATCAAGG AACACTAGAT CTACTCATAG ATCTCAATAT AAGACAGAAT AGTTCCTGCA
TAGATAAATG GATGTGGTTT CTAGTTCTGA TTTTAAGTTT TCAGTTAAGG AATCTGGTCT GGGCAACAAC CAAGCATGAT
GTTTACACGG TGCACAACCA ATCAGTGACA CATTGGTCAT CATTGGACCA GACAAGTACT GAGCTAATCA ATGCGGATGA
CTGCATTATA CCAAAACAGG TACCTACTCC ATCCATAGCC TTAGCTCTCA TTGTTGTTGA CTCATCATCT CGTTGGTCCC
TAACTTGCAA AATTATCTTC TTTGTGGACA GAGAGGGCAT GGTTCACAGT CCGTTGCAAT GGTCCAGGTC ACAACTATGG
CTGTAGATGA TAGTTTATTG GTAATTGGTG GTTTTCAGGG GGAGCTTATA TGCAAGGTAT CTTCATAGAA AAACATATAC
TTAAACTTTG CAATTTCATC TAGTAACTTG CAAACTGACA AAATTCTTTG GTTTTTAATA GCGCCTGGAA GATGATGGAG
TTCTTTTCAG CACAAGAGTT ACAGATGATG AGAATGCTAT TACCAACTCT TTGGAGATAT ATCAGGATCC CACGTAAGAC
TTGTTGCTTT TGGAGTTAGC ATGTTTTTAC TTCCAGGCCT TGTAACAACT CTTAACAAAT GTATGTTTTG ATATTTTCAG
TGGATCTAGA CGGTTGGTGG CTGCTAACAA TGACTGCTCT GTCAGAATTT TTGACATTGA GTACTTTGAT TTGCTGAAGC
ACTATGTCTT CCCATGGTCT GTGAATGTAA GTAGCCTCTC TATACTTGTT TATCCCCTTG GTTATGTGCC TTCTTTTGTC
TCCCAAGTCT CAGATTTTAG TTTTCAATCA GAGCGTTTCG GTGAGCCCAA AAGGGGGACT GTTTGCTGTC CTTGGGGACC
ATGAGGATGG CTTGGTAGTG GATCCCAAGT GTGGCAAGGT AAGTGCATGA CTATTTTGAC CCAATGTGTG AGgttgtagc
ggcttctgat tttttttatc ttaatctgta attgcttctc ttgctttagg caatcggtgc acttaagggt cacttggatt
actctttCGC ATCTGCCTGG CATCCTGATG GCAATATCTT GGCTACCGGC AGTCAAGATA CAACCTGTCG GCTGTGGGAC
ATTAGAAACC TATCAGAGTC TGTGGCTGTA CTTGGCGGAA GGATGGGCTC GATACGTTGC ATCAAGTTCT CTTCAGACGG
GCGGTTCTTG GCTACTGCAG AACCTGTGGA TTTCGTCCAT ATCTACGATT CATATGCAGA CTATGGCAGA TCTCACGAGA
TTGACTTGTT TGGAGAGATT GCTGGATTGT CATTCAGCCC AGACGCCGAG GCCTTGTACG TTGGCATAGC AGATCCAACA
TACGGTGGCC TCATAGAGTT CAACAGGAGG CACCAACATC ATTATTTGAA CTGCATGTGG TGATGCCATT TGTTAAGCGA
AATGTGCGTC TTTGCTGAGC TTAGCAGTCC TCCGATTATG TGCTGCATAA CTTGCACAAC TTGTGGAAGG CGCACTAATA
GTGAAAAGCT CATTAAAGAA ATTTTGCTGC TTTAGTTTTT AGCTGCAGCA CCTGAAGCTC ATGAATGGCC CCGAACTGTA
AAATTCTGTC CCTTTTGTCT AAAATGTCAC TTAGGAACTG ATGGAGGTAG ATATATATGT ATAGCCGTCC TATTTCATTT
TTCTCCAAAT CGATGTACAT ATAGTTGTGG TATCCCGGTT CTTTGCAACG CAACGAGCAT TGGCAACAAA ATAGCAAGGA
TAAATTATGC CAGAAGTGGA TGGTTCGGCA CATCCGGAAG AAGATTTTAG CTCAATGATC ATATGTGTTC CACTCGGTTG
TTCGGCTCTC GTTTATACAA GAACAGGGAA TTTCCCAGCA GCGACCTTTT CAGTCCTTGG GACACGTAGA AATTGCTAGT
CGGTGGCTCG GAGCCGTTCT CTCTTTATCA AACCGAACAT GCTTGGAATT CTCTATTATC ATAATTTTGC AATATCCATT
TATAGATATT GAAATCAAAG TACGTTACAT CC

Locus: Os08g0408200

Loading...

Locus: Os08g0408200

Loading...