Os08t0408500-01

Locus

Os08g0408500

Description

Drought-inducible transcriptional activator, ERF transcription factor, Regulation of calmodulin-like protein, Drought tolerance, Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsERF48, OsDRAP1

RAP-DB Gene Name Synonym(s)

ethylene response factor 48, Drought Responsive AP2/EREBP gene 1

CGSNL Gene Symbol

ERF48

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 48

Oryzabase Gene Symbol Synonym(s)

OsERF#048, OsERF048, OsERF48, AP2/EREBP#170, AP2/EREBP170

Oryzabase Gene Name Synonym(s)

ethylene response factor 48, APETALA2/ethylene-responsive element binding protein 170

Transcript Evidence

AK105725

AK068312

Protein Evidence

Q6Z9V4

Literature

PMID: 33664392

PMID: 28244201

Note

Manual Curation

March 8, 2021

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

AP2/ERF domain superfamily (IPR036955)

DNA-binding domain superfamily (IPR016177)

AP2/ERF domain (IPR001471)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-201-G08 (Online Clone Ordering)

J013151K12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0408500-01)

RiceXPro (AK105725)

Others

Oryzabase (10565)

KEGG (Os08t0408500-01)

Transcript

1651 bp

>Os08t0408500-01 Drought-inducible transcriptional activator, ERF transcription factor, Regulation of calmodulin-like protein, Drought tolerance, Salt tolerance
AAACCCAAACGACGGAGACCCACTACTCCGAGCCATCAAGAACACACACACATCCAGAAA
GCCTAATCCAATCCAAAAGCCCTAATCACCCAGACTCCATCTCTGTGAGGTTTGAGAGAG
GTAGGTGAGCCGTAGATCTGAGCGAGTTCTTGGGTCTTCCAGCAGGTAGATCACTTCATC
TGAGGATCAATCTTTTTTTTTTTCCTTTGTTTTTGAGCTTCTGTTGGTGTACAGGACAGA
GAGTTCCAGAGCCTTTTAGTTTCTGGTGTTCTGATCTGTTCTTGGTGTAAGATTATTGGT
CTGATTTGGTAGCCAAGAGGGTTAATTTTTTCCACACCTCCTTGTGCTAGTTAGCTTAGC
TTATACCCCCCTTGTAAAGTGATTAGTAGATCTAGAACTTCTCTTTTCGTCTGCCAGTTC
TTGGATTTTGGAAAGAACAGGTGGTTTGTTATTCAGATTTTTAGGTTAGAAAAAATCCAC
AAAAAAAAAGATATTCGATGGCAGCTGCTATAGAAGGAAATCTGATGCGGGCGCTGGGAG
AGGCTCCGTCGCCGCAGATGCAGAAGATCGCGCCGCCGCCGTTTCATCCCGGCTTGCCGC
CGGCGCCGGCGAACTTCTCCTCGGCCGGAGTCCACGGGTTCCACTACATGGGCCCGGCCC
AGCTCAGCCCGGCCCAGATCCAGCGCGTCCAGGCCCAACTCCACATGCAGCGGCAGGCCC
AGTCGGGGCTCGGCCCGCGGGCCCAGCCCATGAAGCCCGCTTCGGCGgctgctccggcgg
cggcggcggcgcgggcgcagaagctgtaccgcggcgtgcggcagcggcactggggcaagt
gggtggcggagatccggctgccgcgcaaccgcaccaggctctggctcggcaccttcgaca
ccgccgaggaggcggcgctcacctacgaccaggccgcgtaccgcctccgcggcgacgcgg
cgcggctcaacttcccggacaacgccgcgtcgcggggcccgctcgacgccgccgtggacg
ccaagctccaggccatctgcgacaccatcgcCGCGTCCAAGAACGCCTCATCCAGGTCCA
GGGGCGGCGCCGGCAGGGCCATGCCCATCAACGCGCCCCTGGTCGCCGCGGCGTCGTCGT
CCTCCGGCTCCGACCACTCCGGCGGCGGCGACGACGGCGGCTCGGAGACGTCGTCGTCGT
CTGCGGCGGCGTCGCCGCTGGCGGAGATGGAGCAGCTGGACTTCAGCGAGGTGCCGTGGG
ACGAGGCGGAGGGGTTCGCGCTCACCAAGTACCCGTCGTACGAGATCGACTGGGACTCGC
TGCTCAACAACAATAACTAGCTCTTCTCTTCCATAGCCCGCCATTGCCGGCCGGCGCAGA
TGAGGTTTTAGGCATTCTGCGCGGCGGCGAGGCGATGGATTATATGTTCGTTCTTGTGTA
GATCCTTTTCTTTTTGTGTTGGTTTTTTAGGTTCCGGAGGCTGCTCGCCGGCGTCGTTTT
TGTGTCCGGCGTCTCCGATGTCTAGTAAGCAGTGACTCGTTAGTGTAGTAGTTGTACAAC
TCTACAAATGTACAAATACTTGTGCATGTAGGTTGTTGTAATCAATTGTTGGTAACTACC
TGTAATAGAACTACTGTGAATTAACTGTATT

CDS

843 bp

>Os08t0408500-01 Drought-inducible transcriptional activator, ERF transcription factor, Regulation of calmodulin-like protein, Drought tolerance, Salt tolerance
ATGGCAGCTGCTATAGAAGGAAATCTGATGCGGGCGCTGGGAGAGGCTCCGTCGCCGCAG
ATGCAGAAGATCGCGCCGCCGCCGTTTCATCCCGGCTTGCCGCCGGCGCCGGCGAACTTC
TCCTCGGCCGGAGTCCACGGGTTCCACTACATGGGCCCGGCCCAGCTCAGCCCGGCCCAG
ATCCAGCGCGTCCAGGCCCAACTCCACATGCAGCGGCAGGCCCAGTCGGGGCTCGGCCCG
CGGGCCCAGCCCATGAAGCCCGCTTCGGCGgctgctccggcggcggcggcggcgcgggcg
cagaagctgtaccgcggcgtgcggcagcggcactggggcaagtgggtggcggagatccgg
ctgccgcgcaaccgcaccaggctctggctcggcaccttcgacaccgccgaggaggcggcg
ctcacctacgaccaggccgcgtaccgcctccgcggcgacgcggcgcggctcaacttcccg
gacaacgccgcgtcgcggggcccgctcgacgccgccgtggacgccaagctccaggccatc
tgcgacaccatcgcCGCGTCCAAGAACGCCTCATCCAGGTCCAGGGGCGGCGCCGGCAGG
GCCATGCCCATCAACGCGCCCCTGGTCGCCGCGGCGTCGTCGTCCTCCGGCTCCGACCAC
TCCGGCGGCGGCGACGACGGCGGCTCGGAGACGTCGTCGTCGTCTGCGGCGGCGTCGCCG
CTGGCGGAGATGGAGCAGCTGGACTTCAGCGAGGTGCCGTGGGACGAGGCGGAGGGGTTC
GCGCTCACCAAGTACCCGTCGTACGAGATCGACTGGGACTCGCTGCTCAACAACAATAAC
TAG

Protein

281 aa

>Os08t0408500-01 Drought-inducible transcriptional activator, ERF transcription factor, Regulation of calmodulin-like protein, Drought tolerance, Salt tolerance
MAAAIEGNLMRALGEAPSPQMQKIAPPPFHPGLPPAPANFSSAGVHGFHYMGPAQLSPAQ
IQRVQAQLHMQRQAQSGLGPRAQPMKPASAAAPAAAAARAQKLYRGVRQRHWGKWVAEIR
LPRNRTRLWLGTFDTAEEAALTYDQAAYRLRGDAARLNFPDNAASRGPLDAAVDAKLQAI
CDTIAASKNASSRSRGGAGRAMPINAPLVAAASSSSGSDHSGGGDDGGSETSSSSAAASP
LAEMEQLDFSEVPWDEAEGFALTKYPSYEIDWDSLLNNNN*

5'UTR

chr08:19547328..19547824 (+ strand) : 497 bp

CDS

chr08:19547825..19548667 (+ strand) : 843 bp

3'UTR

chr08:19548668..19548978 (+ strand) : 311 bp

FASTA

>Os08t0408500-01 class=Sequence position=chr08:19547328..19548978 (+ strand)
AAACCCAAAC GACGGAGACC CACTACTCCG AGCCATCAAG AACACACACA CATCCAGAAA GCCTAATCCA ATCCAAAAGC
CCTAATCACC CAGACTCCAT CTCTGTGAGG TTTGAGAGAG GTAGGTGAGC CGTAGATCTG AGCGAGTTCT TGGGTCTTCC
AGCAGGTAGA TCACTTCATC TGAGGATCAA TCTTTTTTTT TTTCCTTTGT TTTTGAGCTT CTGTTGGTGT ACAGGACAGA
GAGTTCCAGA GCCTTTTAGT TTCTGGTGTT CTGATCTGTT CTTGGTGTAA GATTATTGGT CTGATTTGGT AGCCAAGAGG
GTTAATTTTT TCCACACCTC CTTGTGCTAG TTAGCTTAGC TTATACCCCC CTTGTAAAGT GATTAGTAGA TCTAGAACTT
CTCTTTTCGT CTGCCAGTTC TTGGATTTTG GAAAGAACAG GTGGTTTGTT ATTCAGATTT TTAGGTTAGA AAAAATCCAC
AAAAAAAAAG ATATTCGATG GCAGCTGCTA TAGAAGGAAA TCTGATGCGG GCGCTGGGAG AGGCTCCGTC GCCGCAGATG
CAGAAGATCG CGCCGCCGCC GTTTCATCCC GGCTTGCCGC CGGCGCCGGC GAACTTCTCC TCGGCCGGAG TCCACGGGTT
CCACTACATG GGCCCGGCCC AGCTCAGCCC GGCCCAGATC CAGCGCGTCC AGGCCCAACT CCACATGCAG CGGCAGGCCC
AGTCGGGGCT CGGCCCGCGG GCCCAGCCCA TGAAGCCCGC TTCGGCGgct gctccggcgg cggcggcggc gcgggcgcag
aagctgtacc gcggcgtgcg gcagcggcac tggggcaagt gggtggcgga gatccggctg ccgcgcaacc gcaccaggct
ctggctcggc accttcgaca ccgccgagga ggcggcgctc acctacgacc aggccgcgta ccgcctccgc ggcgacgcgg
cgcggctcaa cttcccggac aacgccgcgt cgcggggccc gctcgacgcc gccgtggacg ccaagctcca ggccatctgc
gacaccatcg cCGCGTCCAA GAACGCCTCA TCCAGGTCCA GGGGCGGCGC CGGCAGGGCC ATGCCCATCA ACGCGCCCCT
GGTCGCCGCG GCGTCGTCGT CCTCCGGCTC CGACCACTCC GGCGGCGGCG ACGACGGCGG CTCGGAGACG TCGTCGTCGT
CTGCGGCGGC GTCGCCGCTG GCGGAGATGG AGCAGCTGGA CTTCAGCGAG GTGCCGTGGG ACGAGGCGGA GGGGTTCGCG
CTCACCAAGT ACCCGTCGTA CGAGATCGAC TGGGACTCGC TGCTCAACAA CAATAACTAG CTCTTCTCTT CCATAGCCCG
CCATTGCCGG CCGGCGCAGA TGAGGTTTTA GGCATTCTGC GCGGCGGCGA GGCGATGGAT TATATGTTCG TTCTTGTGTA
GATCCTTTTC TTTTTGTGTT GGTTTTTTAG GTTCCGGAGG CTGCTCGCCG GCGTCGTTTT TGTGTCCGGC GTCTCCGATG
TCTAGTAAGC AGTGACTCGT TAGTGTAGTA GTTGTACAAC TCTACAAATG TACAAATACT TGTGCATGTA GGTTGTTGTA
ATCAATTGTT GGTAACTACC TGTAATAGAA CTACTGTGAA TTAACTGTAT T

Locus: Os08g0408500

Loading...

Locus: Os08g0408500

Loading...