Os08t0424500-01

Locus

Os08g0424500

Description

Betaine aldehyde dehydrogenase, Rice fragrance

RAP-DB Gene Symbol Synonym(s)

SK2(T)(SCL, FGR), sk2(t)(scl, fgr), fgr, scl, BAD2, BADH2, sk2, OsBADH2, Badh2, badh2, Os2AP, BADH-2

RAP-DB Gene Name Synonym(s)

SCENTED KERNEL 2, scented kernel2, scented kernel 2, fragrance, betaine-aldehyde dehydrogenase 2, betaine aldehyde dehydrogenase 2, scented kernel-2, betaine aldehyde dehydrogenase-2

CGSNL Gene Symbol

SK2(T)(SCL, FGR)

CGSNL Gene Name

SCENTED KERNEL 2

Oryzabase Gene Symbol Synonym(s)

sk2(t)(scl, fgr), fgr, scl, BAD2, BADH2, sk2, OsBADH2, Badh2, badh2, Os2AP, BADH-2, OsALDH10A8, ALDH10A8

Oryzabase Gene Name Synonym(s)

scented kernel2, scented kernel 2, fragrance, betaine-aldehyde dehydrogenase 2, betaine aldehyde dehydrogenase 2, scented kernel-2, betaine aldehyde dehydrogenase-2, Aldehyde dehydrogenase 10A8

Transcript Evidence

AK071221 (Genbank)

Protein Evidence

Q84LK3 (UniProt)

Literature

PMID: 17129318

PMID: 18491070

PMID: 18599581

Note

Manual Curation

July 14, 2009

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J023088C02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0424500-01)

RiceXPro (AK071221)

Others

Oryzabase (829)

KEGG (Os08t0424500-01 (EC:1.2.1.3))

Transcript

1805 bp

>Os08t0424500-01 Betaine aldehyde dehydrogenase, Rice fragrance
AGAACAGAGCACTCCCTCTCCCACCACCACTCCACACCTGACACCACGCGGGCTGCCTCC
ATCGTCATCGATCCATCTCCGTATCTCTCACCGACCCCAAATCGCACAGCTCCAGCTCCT
CCTCGATCCCCGTCGCGATCGGCGAGATGGCCACGGCGATCCCGCAGCGGCAGCTCTTCG
TCGCCGGCGAGTGGCGCGCCCCCGCGCTCGGCCGCCGCCTCCCCGTCGTCAACCCCGCCA
CCGAGTCCCCCATCGGCGAGATCCCGGCGGGCACGGCGGAGGACGTGGACGCGGCGGTGG
CGGCGGCGCGGGAGGCGCTGAAGAGGAACCGGGGCCGCGACTGGGCGCGCGCGCCGGGCG
CCGTCCGGGCCAAGTACCTCCGCGCAATCGCGGCCAAGATAATCGAGAGGAAATCTGAGC
TGGCTAGACTAGAGACGCTTGATTGTGGGAAGCCTCTTGATGAAGCAGCATGGGACATGG
ACGATGTTGCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGAATCCTTGGACAAAAGGC
AAAATGCACCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTA
TCGGTGTAGTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGG
TAGCTCCTGCCCTGGCTGCTGGCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCG
TGACTTGTTTGGAGCTTGCTGATGTGTGTAAAGAGGTTGGTCTTCCTTCAGGTGTGCTAA
ACATAGTGACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACCCTGGTGTAG
ACAAGGTTGCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTC
CTATGGTTAAGCCTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATG
ATGTTGATGTTGAAAAAGCTGTTGAGTGGACTCTCTTTGGTTGCTTTTGGACCAATGGCC
AGATTTGCAGTGCAACATCGCGTCTTATTCTTCATAAAAAAATCGCTAAAGAATTTCAAG
AAAGGATGGTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGCA
GGCTTGGGCCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCG
CCAAAAGCCAAGGTGCTACCATTCTGACTGGTGGGGTTAGACCCAAGcatctggagaaag
gtttctatattgaacccacaatcattactgatgtcgatacatcaatgcaaatttggaggg
aagaagtttttggtccagtgctctgtgtgaaagaatttagcactgaagaagaagccattg
aattggcCAACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGC
GATGCCAGAGATTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAAC
CCTGCTTCTGCCAAGCTCCATGGGGCGGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCG
GAGAAGGGGGCATTGACAACTACCTAAGCGTCAAGCAAGTGACGGAGTACGCCTCCGATG
AGCCGTGGGGATGGTACAAATCCCCTTCCAAGCTGTAATGTAATATGCGCATACGCATGA
CACGCCCATCTGTTCTGATCGTTTGGAATAAGAGGCCATAGTATGACGGGATGGACTTTG
TGCATATCGATGTTTGATTTGCCATGTGCTGAGCCTGGAAATAAAAAAGGTTATAGTTGG
AGACT

CDS

1512 bp

>Os08t0424500-01 Betaine aldehyde dehydrogenase, Rice fragrance
ATGGCCACGGCGATCCCGCAGCGGCAGCTCTTCGTCGCCGGCGAGTGGCGCGCCCCCGCG
CTCGGCCGCCGCCTCCCCGTCGTCAACCCCGCCACCGAGTCCCCCATCGGCGAGATCCCG
GCGGGCACGGCGGAGGACGTGGACGCGGCGGTGGCGGCGGCGCGGGAGGCGCTGAAGAGG
AACCGGGGCCGCGACTGGGCGCGCGCGCCGGGCGCCGTCCGGGCCAAGTACCTCCGCGCA
ATCGCGGCCAAGATAATCGAGAGGAAATCTGAGCTGGCTAGACTAGAGACGCTTGATTGT
GGGAAGCCTCTTGATGAAGCAGCATGGGACATGGACGATGTTGCTGGATGCTTTGAGTAC
TTTGCAGATCTTGCAGAATCCTTGGACAAAAGGCAAAATGCACCTGTCTCTCTTCCAATG
GAAAACTTTAAATGCTATCTTCGGAAAGAGCCTATCGGTGTAGTTGGGTTGATCACACCT
TGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCTGCCCTGGCTGCTGGCTGT
ACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGTTTGGAGCTTGCTGATGTG
TGTAAAGAGGTTGGTCTTCCTTCAGGTGTGCTAAACATAGTGACTGGATTAGGTTCTGAA
GCCGGTGCTCCTTTGTCATCACACCCTGGTGTAGACAAGGTTGCATTTACTGGGAGTTAT
GAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTTAAGCCTGTTTCACTGGAA
CTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGATGTTGAAAAAGCTGTTGAG
TGGACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGCAGTGCAACATCGCGTCTT
ATTCTTCATAAAAAAATCGCTAAAGAATTTCAAGAAAGGATGGTTGCATGGGCCAAAAAT
ATTAAGGTGTCAGATCCACTTGAAGAGGGTTGCAGGCTTGGGCCCGTTGTTAGTGAAGGA
CAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGCCAAGGTGCTACCATTCTG
ACTGGTGGGGTTAGACCCAAGcatctggagaaaggtttctatattgaacccacaatcatt
actgatgtcgatacatcaatgcaaatttggagggaagaagtttttggtccagtgctctgt
gtgaaagaatttagcactgaagaagaagccattgaattggcCAACGATACTCATTATGGT
CTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCAGAGATTAACTGAGGAGATC
GATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTCTGCCAAGCTCCATGGGGC
GGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGGGGCATTGACAACTACCTA
AGCGTCAAGCAAGTGACGGAGTACGCCTCCGATGAGCCGTGGGGATGGTACAAATCCCCT
TCCAAGCTGTAA

Protein

504 aa

>Os08t0424500-01 Betaine aldehyde dehydrogenase, Rice fragrance
MATAIPQRQLFVAGEWRAPALGRRLPVVNPATESPIGEIPAGTAEDVDAAVAAAREALKR
NRGRDWARAPGAVRAKYLRAIAAKIIERKSELARLETLDCGKPLDEAAWDMDDVAGCFEY
FADLAESLDKRQNAPVSLPMENFKCYLRKEPIGVVGLITPWNYPLLMATWKVAPALAAGC
TAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLGSEAGAPLSSHPGVDKVAFTGSY
ETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVEKAVEWTLFGCFWTNGQICSATSRL
ILHKKIAKEFQERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKQFVSTAKSQGATIL
TGGVRPKHLEKGFYIEPTIITDVDTSMQIWREEVFGPVLCVKEFSTEEEAIELANDTHYG
LAGAVLSGDRERCQRLTEEIDAGIIWVNCSQPCFCQAPWGGNKRSGFGRELGEGGIDNYL
SVKQVTEYASDEPWGWYKSPSKL*

5'UTR

chr08:20379823..20379968 (+ strand) : 146 bp

CDS

chr08:20379969..20380077 (+ strand) : 109 bp

chr08:20380177..20380319 (+ strand) : 143 bp

chr08:20381372..20381452 (+ strand) : 81 bp

chr08:20381548..20381696 (+ strand) : 149 bp

chr08:20382394..20382486 (+ strand) : 93 bp

chr08:20382618..20382741 (+ strand) : 124 bp

chr08:20382826..20382891 (+ strand) : 66 bp

chr08:20383082..20383148 (+ strand) : 67 bp

chr08:20383841..20383917 (+ strand) : 77 bp

chr08:20384273..20384386 (+ strand) : 114 bp

chr08:20384787..20384864 (+ strand) : 78 bp

chr08:20384946..20385097 (+ strand) : 152 bp

chr08:20385201..20385261 (+ strand) : 61 bp

chr08:20385533..20385639 (+ strand) : 107 bp

chr08:20385738..20385828 (+ strand) : 91 bp

3'UTR

chr08:20385829..20385975 (+ strand) : 147 bp

FASTA

>Os08t0424500-01 class=Sequence position=chr08:20379823..20385975 (+ strand)
AGAACAGAGC ACTCCCTCTC CCACCACCAC TCCACACCTG ACACCACGCG GGCTGCCTCC ATCGTCATCG ATCCATCTCC
GTATCTCTCA CCGACCCCAA ATCGCACAGC TCCAGCTCCT CCTCGATCCC CGTCGCGATC GGCGAGATGG CCACGGCGAT
CCCGCAGCGG CAGCTCTTCG TCGCCGGCGA GTGGCGCGCC CCCGCGCTCG GCCGCCGCCT CCCCGTCGTC AACCCCGCCA
CCGAGTCCCC CATCGGTACC CTCCTCTTCA CCCTCTCCAC CCTCTGCTTC TGCCTCTGAT TAGCCTTTTT GTTGTTGTTG
TTGTTGCTGC TGTTTTTTGC GTGTCGGTGC GCAGGCGAGA TCCCGGCGGG CACGGCGGAG GACGTGGACG CGGCGGTGGC
GGCGGCGCGG GAGGCGCTGA AGAGGAACCG GGGCCGCGAC TGGGCGCGCG CGCCGGGCGC CGTCCGGGCC AAGTACCTCC
GCGCAATCGC GGCCAAGGTA GGGTGGTGAC TACCCCCACC CCCCCCCCCC CCCCCAACGC GACCCGCGTG CGTGTGTTCC
GTACAGGGGG AGGAGCTCCG CGTGGCTCTC CAGTAGGTTT TTGAGCCCCA AATCGATCGA TATGCTCTAG TTTTAAGTTT
GCTGCTTAAA TTCCTCAAGG GTTTAGTTTG CAACCAAATC CTTATTTTAG CTTCGGTATA AGCCCCCCAT ATGATGTGCG
TGCGTCGGCA TCGGAAGTGC GTATCCTCTG TTCTGGACTA GGAATTGGCC ATAGGTTGAT CGACAGTTCG AGTATTCTGC
TTCTGTTTGG AATAAGTTGG AAGCATGGCT GATTGTGTAT CTGGATGCTG TTTTTGTGGT GATTCGTTTC AAGCTCTTGT
TAATTGATGG GTTCAAGCGG AGAGGGTGCG CAACAACAAG TGTATATGGC TCACGGCCAT GGGTGTGCAC ATTTGATTGG
TGCGCAACAA CAAGTGTATA TTGTTTGTGT GCTTCGTTAG TTGGCAGGTC CTAGTCACTA AATCACTATT GGATTGGTAC
TAGTTACTTT TGTGCCTTGA CGATGGGACT GGATTACTAG CCTTTTGGTT GCCTTTGTGG TATTCCGTTG TTATGGGCCT
GTTGATGGAT GGATCCCTTT AATTTCTAGT GCCAAATGCA TGCTAGATTT CTCACAGTTT TTCTCTTCAG GTTATATTTC
TCGTATTTCC TTTTCCTAAA GGATTGCTTT TTCATGTATT TTCTGGCATA TATAGGTTAT TATTATTATT ATTCTCCAGA
ACAAGATTAC CCATATTATG GATCACTAGT GTACACTTTT TTGGATGAAA AACCTACTTA CTGAAAGTAA AACAGTGACC
AGTGCACACT TTACTTGAAC TGTCAAACCA TCAATTTTCT AGCAAAGCAG GGGATGCTAG CCTTCCAGTC TAAATGACAG
TAAACTACTA TACTTTTGTC CGTAGGTTTG GAAATATGCT AATTTCTATC ATAAAAATTT TCATGGCATA TGCGAGCATT
TTATGATCAC CTTTTCCCTT TTTCTTCAGA TAATCGAGAG GAAATCTGAG CTGGCTAGAC TAGAGACGCT TGATTGTGGG
AAGCCTCTTG ATGAAGCAGC ATGGGACATG GTATGTGGCC AGTTATCCAC TGTATGAATA TGTAGTTGCC TACACAGCAA
TCTTTCCTGA ACATGAATCC TGATGTATGA TATTCCATTT GTCAGGACGA TGTTGCTGGA TGCTTTGAGT ACTTTGCAGA
TCTTGCAGAA TCCTTGGACA AAAGGCAAAA TGCACCTGTC TCTCTTCCAA TGGAAAACTT TAAATGCTAT CTTCGGAAAG
AGCCTATCGG TGTAGTTGGG TTGATCACAC CTTGGTATTT CACATTTTTC TCTCATCCTG CGCTTATATT TATTTATGAC
CCAAGCATGG TACTAAATAG TACTAGTAAC ATGCATATAC TGAATGAGTT TACAACTTTA CATGATTTTT TTGAACTATG
AAAGTTGAAG ACATTTGAGA TTTTATTCCT CTTCTCTTGT GCAAACATAT TATTGTCTCA CAAATTGTAC CTAGCAGCta
ctctctccgt ttcatattat aagtcgtttg acttttttcc tagtcaaaat gtgttaagtt tgaccaagtt tatagaaaaa
tttagcaaca tctaaaatat caaaGTCATG TTTTAGTGTT TTTTCAGGCT CTCATGTAAG CAATTTTGat gtgccctctc
ctttcttctt aatataatga tacacagctc ttgtgtattc aaaggaaaaT ATATATATAT ATAATGATAC ACACCTCTCC
TCCGTGTTAA TGCAGCTCAT TTGTTCTGTC CCGGTTCAAA TATCTATTTT TCTCATATGT TGTCAGCATG ATTCACTTAA
TTTAGTATAT AGAAGATGCC ATTATTTATG TCTGGAATCT TACTGCAGAA GGGAAAACAA TTGATAACGG AATTGATTGC
ATTCTAATTT GTTGTTTCTT TGTTATGTTC TTATCGACAA TTACAAATTT GATTCTGAGA ATCATGTTCG GGATGTGTAT
TTCTACTGCA GGAACTATCC TCTCCTGATG GCAACATGGA AGGTAGCTCC TGCCCTGGCT GCTGGCTGTA CAGCTGTACT
AAAACCATCT GAATTGGCTT CCGTGTAAGT TTAACATGTT AACTTGTTAA TGTCATACCC ATGCTAGTTG CAATGACATT
TGATTTTAAA ATGTTGTGGC ATGTCCATGC TGCAAGCAAT GTAATTTGAA ATCTCTCTCT ATCATTAATT ACCAGGACTT
GTTTGGAGCT TGCTGATGTG TGTAAAGAGG TTGGTCTTCC TTCAGGTGTG CTAAACATAG TGACTGGATT AGGTTCTGAA
GCCGGTGCTC CTTTGTCATC ACACCCTGGT GTAGACAAGG TACAGCTATT CCTCCTGTAA TCATGTATAC CCCATCAATG
GAAATGATAT TCCTCTCAAT ACATGGTTTA TGTTTTCTGT TAGGTTGCAT TTACTGGGAG TTATGAAACT GGTAAAAAGA
TTATGGCTTC AGCTGCTCCT ATGGTTAAGG TTTGTTTCCA AATTTCTGTG GATATTTTTT GTTCTCTTTC TACTAACTCT
CTATTATCAA TTCTCAATGT TGTCCTTTTC TTTTAACTCC TTTACTTTTT AGAATTGTGA TCAAGACACT TTGAGCATCA
TTCTAGTAGC CAGTTCTATC CTGTTTCTTA CCTTTTTATG GTTCGTCTTT TCTTGACAGC CTGTTTCACT GGAACTTGGT
GGAAAAAGTC CTATAGTGGT GTTTGATGAT GTTGATGTTG AAAAAGGTAC ATGCCACTTG CTATGATTAA CTAATTCTGA
AGTGCGGGAC TTTGTAAAGC ACTTAACTGA GCTGGATGCT AGACCCCCAA AAGCCCTTTT TGGTGTCTTG GGCTTGTTGC
AGAAATACTG GTCCCAGACG AGCAGGATGC AAGAAAATTA ACTACTTTTG CCACTGATTA GTATTTCTTA GAAGTTACAC
CTCAAGGATT AGCAATACTT TCTTAAAATG TGCTATTGAT TAAAAAGATG TCCTGTATTA TTTTGAGCAG ATCTTGTACT
GGTTGATCGG CTTGCATGAA AATATTGTTG AGGATTATAA TGCCATGCCA ACTGAGTAAA GAAAAGAGTT GTAAAATATG
TTATGCAACA TGAATATATA TGTGATTTCA TTTTTCCTTT TTCTTTTCGT GGCAAGGAAG GCAGTTAGGA AGGACTGATG
TGAAAAGCAC AAGTACTATT CTTAGTTCTG GAAAACTGTG TTCTTTATTT TCCTAACTAC AATTCACCTT GATTAGTCAG
TAACTTGATA TTGGCAATTC TAGCTGATTA TGAATTCTGT TTATATTTCA CTAATTTTGA ATCTTTAATT ACATTTTATG
GTTGAAATTT AACGTTTTGT CTGGTTATGG ACTCTGTTTG TATTCACTCA ATTTGGATCT TCCATTAGAT TTCATTGTTG
GTCCTTCTTC TTGTACAGCT GTTGAGTGGA CTCTCTTTGG TTGCTTTTGG ACCAATGGCC AGATTTGCAG TGCAACATCG
CGTCTTATTC TTCATGTAAG CATTGAATAT ATCCGTCAAT CATAATCTAT TGTTGTACTT GATTTTTTTT CTGATCAACT
CCTGAGTTCA GATTATTATA TGATGCCATT ACTATTGCAC AGAGCGAATA AAATTGTATT TATGCACAGC ATGTATTTTG
AGTAATATAT GCATTGCCTA TTATTTAATA TATAGATTGT AGCACTTAAT TTTGTGTCCA TGTCTCTATG ATGTTTATTA
CTTTATTATT GCCGGCATGA AGCAACTTTG AACTCTATGT TGATCTTGAA CTAAAATTGA AATTAATTGG CTTATTGCTA
TTAATGATAT AGCTTTCAGC TTCTTGCTCC TGACCATGAA AGTTTTGCAG AAAAAAATCG CTAAAGAATT TCAAGAAAGG
ATGGTTGCAT GGGCCAAAAA TATTAAGGTG TCAGATCCAC TTGAAGAGGG TTGCAGGCTT GGGCCCGTTG TTAGTGAAGG
ACAGGTACCA CATGTAAACT TTTTCTAAAT TCAAAAAAGA AATGCCACTG ATCAATGGTA GGTCCTTCCA AGCCTTATTG
CTGGATTGTT GCACTGTTTT GTCAATTTTG TGTAATATAG TTCTGAATGA ATTAGTCGGT GTATGCTCTT GCTAGTTGCT
AGTATGTGGT ACAGGGTCTT CCTACTTTGA GCAAATTCGT GTTAAAATGC ATTGATGAAA AGGCCACCTT TCCGTAGGTT
TATCTTGTCA TAATTTAAAC CCCAATAAAA TTTTAATTTT TTGTTTTGAC CCCATGGCAC TTTAATGAAA TCACTTAGCC
ATGAGCTTTT GTATATATTT TCAAAGCACC AGAATGTTTA GATGGTTTGT TGGAAATCTT ACACATCCTA TTGCCTTGTG
TCAGTATGAG AAGATTAAGC AATTTGTATC TACCGCCAAA AGCCAAGGTG CTACCATTCT GACTGGTGGG GTTAGACCCA
AGGTAATAAT CTACTACACG GTTGTATATA TAGGTACCCA CATATCATTA TGAAGTAGAA ATAATCTTGT ATGTTTTTGT
cagcatctgg agaaaggttt ctatattgaa cccacaatca ttactgatgt cgatacatca atgcaaattt ggagggaaga
agtttttggt ccagtgctct gtgtgaaaga atttagcact gaagaagaag ccattgaatt ggcCAACGAT ACTCAGTGAG
TTTTTTTTTT AATACAGTTC ATTGTCCTGT TCAATCTTGC AGCATATGTA TATACTCTGT GGCATATGAA CTTATTCTGC
TACTACTACT TTTGATAGTT ATGGTCTGGC TGGTGCTGTG CTTTCCGGTG ACCGCGAGCG ATGCCAGAGA TTAACTGAGG
TATATCCAAG TGAAGGGGGT TGGCATTGTT TGATTCATAT GACATGGTTG CATCAAGCTG ATATTCAAGA ATCTCATTTA
TTACTTGCAT TCTATGCATC TCCAGTTCTT CCCTGGACTC CGGTCAATGT TAATATAGTT TGTTTGCTAG TAGTATGCTA
CTCCAATTAA GTTGCTCTTC ACTTCCACAT CATCTGATCC ATGACTTTAT ATTTGACCCC TTTTTTTTGC AAAAGAAAGG
GAAATACTTA ACGAAAATTT CCTACTGCAG GAGATCGATG CCGGAATTAT CTGGGTGAAC TGCTCGCAAC CCTGCTTCTG
CCAAGCTCCA TGGGGCGGGA ACAAGCGCAG CGGCTTTGGA CGCGAGCTCG GAGAAGGGTG GGTAGCACAC AACAATCTCA
CTTTAAAACA CCATTTCGAT CGTCTGATGA TCTCGACCTG ACATCATGCC TTTGGTATTT TCATTCACTT TTCAGGGGCA
TTGACAACTA CCTAAGCGTC AAGCAAGTGA CGGAGTACGC CTCCGATGAG CCGTGGGGAT GGTACAAATC CCCTTCCAAG
CTGTAATGTA ATATGCGCAT ACGCATGACA CGCCCATCTG TTCTGATCGT TTGGAATAAG AGGCCATAGT ATGACGGGAT
GGACTTTGTG CATATCGATG TTTGATTTGC CATGTGCTGA GCCTGGAAAT AAAAAAGGTT ATAGTTGGAG ACT

Locus: Os08g0424500

Loading...

Locus: Os08g0424500

Loading...