Os08t0424500-02

Locus

Os08g0424500

Description

Similar to Betaine aldehyde dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SK2(T)(SCL, FGR)

CGSNL Gene Name

SCENTED KERNEL 2

Oryzabase Gene Symbol Synonym(s)

sk2(t)(scl, fgr), fgr, scl, BAD2, BADH2, sk2, OsBADH2, Badh2, badh2, Os2AP, BADH-2, OsALDH10A8, ALDH10A8

Oryzabase Gene Name Synonym(s)

scented kernel2, scented kernel 2, fragrance, betaine-aldehyde dehydrogenase 2, betaine aldehyde dehydrogenase 2, scented kernel-2, betaine aldehyde dehydrogenase-2, Aldehyde dehydrogenase 10A8

Transcript Evidence

AK060461 (DDBJ, Best hit)

Protein Evidence

B3VMC0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

001-012-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0424500-02)

RiceXPro (AK060461)

Others

Oryzabase (829)

KEGG (Os08t0424500-02 (EC:1.2.1.3))

Transcript

1317 bp

>Os08t0424500-02 Similar to Betaine aldehyde dehydrogenase.
GCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGAATCCTTGGACAAAAGGCAAAATGCA
CCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTATCGGTGTA
GTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCT
GCCCTGGCTGCTGGCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGT
TTGGAGCTTGCTGATGTGTGTAAAGAGGTTGGTCTTCCTTCAGGTGTGCTAAACATAGTG
ACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACCCTGGTGTAGACAAGGTT
GCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTT
AAGCCTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGAT
GTTGAAAAAGCTGTTGAGTGGACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGC
AGTGCAACATCGCGTCTTATTCTTCATAAAAAAATCGCTAAAGAATTTCAAGAAAGGATG
GTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGCAGGCTTGGG
CCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGC
CAAGGTGCTACCATTCTGACTGGTGGGGTTAGACCCAAGcatctggagaaaggtttctat
attgaacccacaatcattactgatgtcgatacatcaatgcaaatttggagggaagaagtt
tttggtccagtgctctgtgtgaaagaatttagcactgaagaagaagccattgaattggcC
AACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCAG
AGATTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTC
TGCCAAGCTCCATGGGGCGGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGG
GGCATTGACAACTACCTAAGCGTCAAGCAAGTGACGGAGTACGCCTCCGATGAGCCGTGG
GGATGGTACAAATCCCCTTCCAAGCTGTAATGTAATATGCGCATACGCATGACACGCCCA
TCTGTTCTGATCGTTTGGAATAAGAGGCCATAGTATGACGGGATGGACTTTGTGCATATC
GATGTTTGATTTGCCATGTGCTGAGCCTGGAAATAAAAAAGGTTATAGTTGGAGACT

CDS

1170 bp

>Os08t0424500-02 Similar to Betaine aldehyde dehydrogenase.
GCTGGATGCTTTGAGTACTTTGCAGATCTTGCAGAATCCTTGGACAAAAGGCAAAATGCA
CCTGTCTCTCTTCCAATGGAAAACTTTAAATGCTATCTTCGGAAAGAGCCTATCGGTGTA
GTTGGGTTGATCACACCTTGGAACTATCCTCTCCTGATGGCAACATGGAAGGTAGCTCCT
GCCCTGGCTGCTGGCTGTACAGCTGTACTAAAACCATCTGAATTGGCTTCCGTGACTTGT
TTGGAGCTTGCTGATGTGTGTAAAGAGGTTGGTCTTCCTTCAGGTGTGCTAAACATAGTG
ACTGGATTAGGTTCTGAAGCCGGTGCTCCTTTGTCATCACACCCTGGTGTAGACAAGGTT
GCATTTACTGGGAGTTATGAAACTGGTAAAAAGATTATGGCTTCAGCTGCTCCTATGGTT
AAGCCTGTTTCACTGGAACTTGGTGGAAAAAGTCCTATAGTGGTGTTTGATGATGTTGAT
GTTGAAAAAGCTGTTGAGTGGACTCTCTTTGGTTGCTTTTGGACCAATGGCCAGATTTGC
AGTGCAACATCGCGTCTTATTCTTCATAAAAAAATCGCTAAAGAATTTCAAGAAAGGATG
GTTGCATGGGCCAAAAATATTAAGGTGTCAGATCCACTTGAAGAGGGTTGCAGGCTTGGG
CCCGTTGTTAGTGAAGGACAGTATGAGAAGATTAAGCAATTTGTATCTACCGCCAAAAGC
CAAGGTGCTACCATTCTGACTGGTGGGGTTAGACCCAAGcatctggagaaaggtttctat
attgaacccacaatcattactgatgtcgatacatcaatgcaaatttggagggaagaagtt
tttggtccagtgctctgtgtgaaagaatttagcactgaagaagaagccattgaattggcC
AACGATACTCATTATGGTCTGGCTGGTGCTGTGCTTTCCGGTGACCGCGAGCGATGCCAG
AGATTAACTGAGGAGATCGATGCCGGAATTATCTGGGTGAACTGCTCGCAACCCTGCTTC
TGCCAAGCTCCATGGGGCGGGAACAAGCGCAGCGGCTTTGGACGCGAGCTCGGAGAAGGG
GGCATTGACAACTACCTAAGCGTCAAGCAAGTGACGGAGTACGCCTCCGATGAGCCGTGG
GGATGGTACAAATCCCCTTCCAAGCTGTAA

Protein

390 aa

>Os08t0424500-02 Similar to Betaine aldehyde dehydrogenase.
AGCFEYFADLAESLDKRQNAPVSLPMENFKCYLRKEPIGVVGLITPWNYPLLMATWKVAP
ALAAGCTAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLGSEAGAPLSSHPGVDKV
AFTGSYETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVEKAVEWTLFGCFWTNGQIC
SATSRLILHKKIAKEFQERMVAWAKNIKVSDPLEEGCRLGPVVSEGQYEKIKQFVSTAKS
QGATILTGGVRPKHLEKGFYIEPTIITDVDTSMQIWREEVFGPVLCVKEFSTEEEAIELA
NDTHYGLAGAVLSGDRERCQRLTEEIDAGIIWVNCSQPCFCQAPWGGNKRSGFGRELGEG
GIDNYLSVKQVTEYASDEPWGWYKSPSKL*

CDS

chr08:20381557..20381696 (+ strand) : 140 bp

chr08:20382394..20382486 (+ strand) : 93 bp

chr08:20382618..20382741 (+ strand) : 124 bp

chr08:20382826..20382891 (+ strand) : 66 bp

chr08:20383082..20383148 (+ strand) : 67 bp

chr08:20383841..20383917 (+ strand) : 77 bp

chr08:20384273..20384386 (+ strand) : 114 bp

chr08:20384787..20384864 (+ strand) : 78 bp

chr08:20384946..20385097 (+ strand) : 152 bp

chr08:20385201..20385261 (+ strand) : 61 bp

chr08:20385533..20385639 (+ strand) : 107 bp

chr08:20385738..20385828 (+ strand) : 91 bp

3'UTR

chr08:20385829..20385975 (+ strand) : 147 bp

FASTA

>Os08t0424500-02 class=Sequence position=chr08:20381557..20385975 (+ strand)
GCTGGATGCT TTGAGTACTT TGCAGATCTT GCAGAATCCT TGGACAAAAG GCAAAATGCA CCTGTCTCTC TTCCAATGGA
AAACTTTAAA TGCTATCTTC GGAAAGAGCC TATCGGTGTA GTTGGGTTGA TCACACCTTG GTATTTCACA TTTTTCTCTC
ATCCTGCGCT TATATTTATT TATGACCCAA GCATGGTACT AAATAGTACT AGTAACATGC ATATACTGAA TGAGTTTACA
ACTTTACATG ATTTTTTTGA ACTATGAAAG TTGAAGACAT TTGAGATTTT ATTCCTCTTC TCTTGTGCAA ACATATTATT
GTCTCACAAA TTGTACCTAG CAGCtactct ctccgtttca tattataagt cgtttgactt ttttcctagt caaaatgtgt
taagtttgac caagtttata gaaaaattta gcaacatcta aaatatcaaa GTCATGTTTT AGTGTTTTTT CAGGCTCTCA
TGTAAGCAAT TTTGatgtgc cctctccttt cttcttaata taatgataca cagctcttgt gtattcaaag gaaaaTATAT
ATATATATAA TGATACACAC CTCTCCTCCG TGTTAATGCA GCTCATTTGT TCTGTCCCGG TTCAAATATC TATTTTTCTC
ATATGTTGTC AGCATGATTC ACTTAATTTA GTATATAGAA GATGCCATTA TTTATGTCTG GAATCTTACT GCAGAAGGGA
AAACAATTGA TAACGGAATT GATTGCATTC TAATTTGTTG TTTCTTTGTT ATGTTCTTAT CGACAATTAC AAATTTGATT
CTGAGAATCA TGTTCGGGAT GTGTATTTCT ACTGCAGGAA CTATCCTCTC CTGATGGCAA CATGGAAGGT AGCTCCTGCC
CTGGCTGCTG GCTGTACAGC TGTACTAAAA CCATCTGAAT TGGCTTCCGT GTAAGTTTAA CATGTTAACT TGTTAATGTC
ATACCCATGC TAGTTGCAAT GACATTTGAT TTTAAAATGT TGTGGCATGT CCATGCTGCA AGCAATGTAA TTTGAAATCT
CTCTCTATCA TTAATTACCA GGACTTGTTT GGAGCTTGCT GATGTGTGTA AAGAGGTTGG TCTTCCTTCA GGTGTGCTAA
ACATAGTGAC TGGATTAGGT TCTGAAGCCG GTGCTCCTTT GTCATCACAC CCTGGTGTAG ACAAGGTACA GCTATTCCTC
CTGTAATCAT GTATACCCCA TCAATGGAAA TGATATTCCT CTCAATACAT GGTTTATGTT TTCTGTTAGG TTGCATTTAC
TGGGAGTTAT GAAACTGGTA AAAAGATTAT GGCTTCAGCT GCTCCTATGG TTAAGGTTTG TTTCCAAATT TCTGTGGATA
TTTTTTGTTC TCTTTCTACT AACTCTCTAT TATCAATTCT CAATGTTGTC CTTTTCTTTT AACTCCTTTA CTTTTTAGAA
TTGTGATCAA GACACTTTGA GCATCATTCT AGTAGCCAGT TCTATCCTGT TTCTTACCTT TTTATGGTTC GTCTTTTCTT
GACAGCCTGT TTCACTGGAA CTTGGTGGAA AAAGTCCTAT AGTGGTGTTT GATGATGTTG ATGTTGAAAA AGGTACATGC
CACTTGCTAT GATTAACTAA TTCTGAAGTG CGGGACTTTG TAAAGCACTT AACTGAGCTG GATGCTAGAC CCCCAAAAGC
CCTTTTTGGT GTCTTGGGCT TGTTGCAGAA ATACTGGTCC CAGACGAGCA GGATGCAAGA AAATTAACTA CTTTTGCCAC
TGATTAGTAT TTCTTAGAAG TTACACCTCA AGGATTAGCA ATACTTTCTT AAAATGTGCT ATTGATTAAA AAGATGTCCT
GTATTATTTT GAGCAGATCT TGTACTGGTT GATCGGCTTG CATGAAAATA TTGTTGAGGA TTATAATGCC ATGCCAACTG
AGTAAAGAAA AGAGTTGTAA AATATGTTAT GCAACATGAA TATATATGTG ATTTCATTTT TCCTTTTTCT TTTCGTGGCA
AGGAAGGCAG TTAGGAAGGA CTGATGTGAA AAGCACAAGT ACTATTCTTA GTTCTGGAAA ACTGTGTTCT TTATTTTCCT
AACTACAATT CACCTTGATT AGTCAGTAAC TTGATATTGG CAATTCTAGC TGATTATGAA TTCTGTTTAT ATTTCACTAA
TTTTGAATCT TTAATTACAT TTTATGGTTG AAATTTAACG TTTTGTCTGG TTATGGACTC TGTTTGTATT CACTCAATTT
GGATCTTCCA TTAGATTTCA TTGTTGGTCC TTCTTCTTGT ACAGCTGTTG AGTGGACTCT CTTTGGTTGC TTTTGGACCA
ATGGCCAGAT TTGCAGTGCA ACATCGCGTC TTATTCTTCA TGTAAGCATT GAATATATCC GTCAATCATA ATCTATTGTT
GTACTTGATT TTTTTTCTGA TCAACTCCTG AGTTCAGATT ATTATATGAT GCCATTACTA TTGCACAGAG CGAATAAAAT
TGTATTTATG CACAGCATGT ATTTTGAGTA ATATATGCAT TGCCTATTAT TTAATATATA GATTGTAGCA CTTAATTTTG
TGTCCATGTC TCTATGATGT TTATTACTTT ATTATTGCCG GCATGAAGCA ACTTTGAACT CTATGTTGAT CTTGAACTAA
AATTGAAATT AATTGGCTTA TTGCTATTAA TGATATAGCT TTCAGCTTCT TGCTCCTGAC CATGAAAGTT TTGCAGAAAA
AAATCGCTAA AGAATTTCAA GAAAGGATGG TTGCATGGGC CAAAAATATT AAGGTGTCAG ATCCACTTGA AGAGGGTTGC
AGGCTTGGGC CCGTTGTTAG TGAAGGACAG GTACCACATG TAAACTTTTT CTAAATTCAA AAAAGAAATG CCACTGATCA
ATGGTAGGTC CTTCCAAGCC TTATTGCTGG ATTGTTGCAC TGTTTTGTCA ATTTTGTGTA ATATAGTTCT GAATGAATTA
GTCGGTGTAT GCTCTTGCTA GTTGCTAGTA TGTGGTACAG GGTCTTCCTA CTTTGAGCAA ATTCGTGTTA AAATGCATTG
ATGAAAAGGC CACCTTTCCG TAGGTTTATC TTGTCATAAT TTAAACCCCA ATAAAATTTT AATTTTTTGT TTTGACCCCA
TGGCACTTTA ATGAAATCAC TTAGCCATGA GCTTTTGTAT ATATTTTCAA AGCACCAGAA TGTTTAGATG GTTTGTTGGA
AATCTTACAC ATCCTATTGC CTTGTGTCAG TATGAGAAGA TTAAGCAATT TGTATCTACC GCCAAAAGCC AAGGTGCTAC
CATTCTGACT GGTGGGGTTA GACCCAAGGT AATAATCTAC TACACGGTTG TATATATAGG TACCCACATA TCATTATGAA
GTAGAAATAA TCTTGTATGT TTTTGTcagc atctggagaa aggtttctat attgaaccca caatcattac tgatgtcgat
acatcaatgc aaatttggag ggaagaagtt tttggtccag tgctctgtgt gaaagaattt agcactgaag aagaagccat
tgaattggcC AACGATACTC AGTGAGTTTT TTTTTTAATA CAGTTCATTG TCCTGTTCAA TCTTGCAGCA TATGTATATA
CTCTGTGGCA TATGAACTTA TTCTGCTACT ACTACTTTTG ATAGTTATGG TCTGGCTGGT GCTGTGCTTT CCGGTGACCG
CGAGCGATGC CAGAGATTAA CTGAGGTATA TCCAAGTGAA GGGGGTTGGC ATTGTTTGAT TCATATGACA TGGTTGCATC
AAGCTGATAT TCAAGAATCT CATTTATTAC TTGCATTCTA TGCATCTCCA GTTCTTCCCT GGACTCCGGT CAATGTTAAT
ATAGTTTGTT TGCTAGTAGT ATGCTACTCC AATTAAGTTG CTCTTCACTT CCACATCATC TGATCCATGA CTTTATATTT
GACCCCTTTT TTTTGCAAAA GAAAGGGAAA TACTTAACGA AAATTTCCTA CTGCAGGAGA TCGATGCCGG AATTATCTGG
GTGAACTGCT CGCAACCCTG CTTCTGCCAA GCTCCATGGG GCGGGAACAA GCGCAGCGGC TTTGGACGCG AGCTCGGAGA
AGGGTGGGTA GCACACAACA ATCTCACTTT AAAACACCAT TTCGATCGTC TGATGATCTC GACCTGACAT CATGCCTTTG
GTATTTTCAT TCACTTTTCA GGGGCATTGA CAACTACCTA AGCGTCAAGC AAGTGACGGA GTACGCCTCC GATGAGCCGT
GGGGATGGTA CAAATCCCCT TCCAAGCTGT AATGTAATAT GCGCATACGC ATGACACGCC CATCTGTTCT GATCGTTTGG
AATAAGAGGC CATAGTATGA CGGGATGGAC TTTGTGCATA TCGATGTTTG ATTTGCCATG TGCTGAGCCT GGAAATAAAA
AAGGTTATAG TTGGAGACT

Locus: Os08g0424500

Loading...

Locus: Os08g0424500

Loading...