Os08t0433500-01

Locus

Os08g0433500

Description

Senescence-associated NAC transcription factor, Negative regulation of leaf senescence, Salt stress tolerance, Plant architecture

RAP-DB Gene Symbol Synonym(s)

NAC106, ONAC106

RAP-DB Gene Name Synonym(s)

NAC DOMAIN-CONTAINING PROTEIN 106, NAC domain-containing protein 106

CGSNL Gene Symbol

NAC106

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 106

Oryzabase Gene Symbol Synonym(s)

ONAC106

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 106

Transcript Evidence

NM_001188667

Protein Evidence

A3BTF2

Literature

PMID: 26443376

Note

Manual Curation

December 21, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain (IPR003441)

Expression Databases

TENOR (Os08t0433500-00)

Others

Oryzabase (15868)

Transcript

1005 bp

>Os08t0433500-01 Senescence-associated NAC transcription factor, Negative regulation of leaf senescence, Salt stress tolerance, Plant architecture
atggaagaggagcagcggttgccggcggggttccggttcttccccaccgacgaggagctc
gtcacctactacctcgccaggaaggccatggacgccaccttcacctccgccgccatccgc
gacgtcgacctctacacctccgatccatggcacctcccatgcgactcgtcggcggcgagc
accggaggcggcggcggcggcgagtgctacttcttctgcagacggagcagcaagtacccg
tccggcgcgcgcgtccgccgcgcgacggccggcggctactggaagtcgacggggaaggac
aagggcgtgtacgctgccggcggcggcggcgggctcgtggggacgaagaagacgctggtg
ttctacgaagggagggcgccgcgaggggagaagacgagctgggtgatgcacgagtaCTCT
AGAGCACCGAGCACCAACTTCATCAGAGGAGCTCAGGCACGTACACATAATCTTCTCGAT
ATTATCTACAGCGAGTGGGTGATCTGCAGGGTGTTCAAGAAGCAGCCTCCAATTGAACAC
TGGCTGGAAatggaggaggtggagacgacgacgacgacgacgacagtgcaggagcacACG
CCAAACCGGCGCCGTCTCCCTCCGGCGGAGGCTGCGGCGGCGCCGCCGCCGCCGTCCGGT
CAGCCGTGGCAACACACGAGTCGCCGGTCCGGCGATGGCCGTGCTGCCATCGATGGTGGC
AACCGTGAGGAGGAGGAGGATGAACATGGCCTGGCTCGAGAGGAGTCGTCGTCTCCGGTG
GTCATCAGCTCACCATCACGCTGCACCTCCTCACCGTCGTCTCGGCTTCTCAACCATGAG
CACCTTGGTGCTTCGTCGTCAGATGACCTGCCGGAGTTGATGGAGTTCGGCGACATCTAC
GGCGGGATCGCCGCCGGTGGCCCGACGGACCAGCAGGCCTCATCATCAAACTCAAATTCC
ATTTGCAACTTTCTCGACGAGCCATACTACTGCTGGAACTTCTGA

CDS

1005 bp

>Os08t0433500-01 Senescence-associated NAC transcription factor, Negative regulation of leaf senescence, Salt stress tolerance, Plant architecture
atggaagaggagcagcggttgccggcggggttccggttcttccccaccgacgaggagctc
gtcacctactacctcgccaggaaggccatggacgccaccttcacctccgccgccatccgc
gacgtcgacctctacacctccgatccatggcacctcccatgcgactcgtcggcggcgagc
accggaggcggcggcggcggcgagtgctacttcttctgcagacggagcagcaagtacccg
tccggcgcgcgcgtccgccgcgcgacggccggcggctactggaagtcgacggggaaggac
aagggcgtgtacgctgccggcggcggcggcgggctcgtggggacgaagaagacgctggtg
ttctacgaagggagggcgccgcgaggggagaagacgagctgggtgatgcacgagtaCTCT
AGAGCACCGAGCACCAACTTCATCAGAGGAGCTCAGGCACGTACACATAATCTTCTCGAT
ATTATCTACAGCGAGTGGGTGATCTGCAGGGTGTTCAAGAAGCAGCCTCCAATTGAACAC
TGGCTGGAAatggaggaggtggagacgacgacgacgacgacgacagtgcaggagcacACG
CCAAACCGGCGCCGTCTCCCTCCGGCGGAGGCTGCGGCGGCGCCGCCGCCGCCGTCCGGT
CAGCCGTGGCAACACACGAGTCGCCGGTCCGGCGATGGCCGTGCTGCCATCGATGGTGGC
AACCGTGAGGAGGAGGAGGATGAACATGGCCTGGCTCGAGAGGAGTCGTCGTCTCCGGTG
GTCATCAGCTCACCATCACGCTGCACCTCCTCACCGTCGTCTCGGCTTCTCAACCATGAG
CACCTTGGTGCTTCGTCGTCAGATGACCTGCCGGAGTTGATGGAGTTCGGCGACATCTAC
GGCGGGATCGCCGCCGGTGGCCCGACGGACCAGCAGGCCTCATCATCAAACTCAAATTCC
ATTTGCAACTTTCTCGACGAGCCATACTACTGCTGGAACTTCTGA

Protein

335 aa

>Os08t0433500-01 Senescence-associated NAC transcription factor, Negative regulation of leaf senescence, Salt stress tolerance, Plant architecture
MEEEQRLPAGFRFFPTDEELVTYYLARKAMDATFTSAAIRDVDLYTSDPWHLPCDSSAAS
TGGGGGGECYFFCRRSSKYPSGARVRRATAGGYWKSTGKDKGVYAAGGGGGLVGTKKTLV
FYEGRAPRGEKTSWVMHEYSRAPSTNFIRGAQARTHNLLDIIYSEWVICRVFKKQPPIEH
WLEMEEVETTTTTTTVQEHTPNRRRLPPAEAAAAPPPPSGQPWQHTSRRSGDGRAAIDGG
NREEEEDEHGLAREESSSPVVISSPSRCTSSPSSRLLNHEHLGASSSDDLPELMEFGDIY
GGIAAGGPTDQQASSSNSNSICNFLDEPYYCWNF*

CDS

chr08:21027757..21027916 (- strand) : 160 bp

chr08:21027278..21027606 (- strand) : 329 bp

chr08:21025942..21026457 (- strand) : 516 bp

FASTA

>Os08t0433500-01 class=Sequence position=chr08:21025942..21027916 (- strand)
atggaagagg agcagcggtt gccggcgggg ttccggttct tccccaccga cgaggagctc gtcacctact acctcgccag
gaaggccatg gacgccacct tcacctccgc cgccatccgc gacgtcgacc tctacacctc cgatccatgg cacctcccat
gtatgcccta gctctagctg atcatgatca tgtgatggtg tctagctcgt tgagagagag agagagaatt tgacagttaa
ttctcgatcg attgatggag atgatgacca tatatatgcg tgacgtgttt tgcgattaac taatgcacag gcgactcgtc
ggcggcgagc accggaggcg gcggcggcgg cgagtgctac ttcttctgca gacggagcag caagtacccg tccggcgcgc
gcgtccgccg cgcgacggcc ggcggctact ggaagtcgac ggggaaggac aagggcgtgt acgctgccgg cggcggcggc
gggctcgtgg ggacgaagaa gacgctggtg ttctacgaag ggagggcgcc gcgaggggag aagacgagct gggtgatgca
cgagtaCTCT AGAGCACCGA GCACCAACTT CATCAGAGGA GCTCAGGCAC GTACACATAA TCTTCTCGAT ATTATCTACG
TATGATTAAT TAGCTTCCCT TAATCCTCAT GGCTCATGCA CGAAGATGCT GTGATACAGT TCAAGTTTTC AAGATTCACT
ACTTCTAAGT TCTAACTGTA CTGGTGATAT TCTTCTACTA TTGGTACGTT GGTGATCCTA AGCAGTGAGT TGGTCGTGTC
TGGGCTCCAT TGATTTATCA GAATACTTGT ATATATATAA AAAAAAGCGT AAATACATTA GGAATTTCAA AGATGTCGAC
ACAATTGGTT TCCAAAAATA ATGGGTAGAA TAGAGTACAT ATATATCGTG TCGATTTTGT GCAACTCTTA ATTTGtactc
cctccgtatt ttaatgtatg acaccgttga ctttttaatc aacgttttac cactcgtctc attcaaattt tttatgcaaa
tataaaagta cttatgtcat acttaaagaa catttgatga taaatgaagt cacgataaaa taaattataa ttacataatt
ttttttaata agacgaaagg tcaaacgttt gttaaaaagt caaagacgtc atacattgaa atacggaggT ATTACCTTAC
AATTCATTCT AATTTATACC TTTCAACTCC ATCGCCAACT TTATCTAATT TTCCTTGATA ACACATGTAA AAAGAAATAA
TCGATCGCTA GCAAACGCTC TTTGTCATCA GGGCTCAACG ATGCCGCTGG CTTCGATCGC CACTTGTTCG TAGTCATTGA
TTTAGGATGG TTGTATCTCA GCAATAGAAA GTGCTCCTAC GGGGATCAGA CGTTGATCGA TGTTCTTGAC GTGTTTTCAT
TAATGTTTCC TCGGTGCAGA GCGAGTGGGT GATCTGCAGG GTGTTCAAGA AGCAGCCTCC AATTGAACAC TGGCTGGAAa
tggaggaggt ggagacgacg acgacgacga cgacagtgca ggagcacACG CCAAACCGGC GCCGTCTCCC TCCGGCGGAG
GCTGCGGCGG CGCCGCCGCC GCCGTCCGGT CAGCCGTGGC AACACACGAG TCGCCGGTCC GGCGATGGCC GTGCTGCCAT
CGATGGTGGC AACCGTGAGG AGGAGGAGGA TGAACATGGC CTGGCTCGAG AGGAGTCGTC GTCTCCGGTG GTCATCAGCT
CACCATCACG CTGCACCTCC TCACCGTCGT CTCGGCTTCT CAACCATGAG CACCTTGGTG CTTCGTCGTC AGATGACCTG
CCGGAGTTGA TGGAGTTCGG CGACATCTAC GGCGGGATCG CCGCCGGTGG CCCGACGGAC CAGCAGGCCT CATCATCAAA
CTCAAATTCC ATTTGCAACT TTCTCGACGA GCCATACTAC TGCTGGAACT TCTGA

Locus: Os08g0433500

Loading...

Locus: Os08g0433500

Loading...