Os08t0436400-00

Locus

Os08g0436400

Description

Zinc finger A20 and AN1 domain-containing stress-associated protein 12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAP12

CGSNL Gene Name

STRESS ASSOCIATED PROTEIN GENE 12

Oryzabase Gene Symbol Synonym(s)

OsSAP12

Oryzabase Gene Name Synonym(s)

stress-associated protein 12

Transcript Evidence

AK372340 (DDBJ)

Protein Evidence

Q6Z541 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, AN1-type (IPR000058)

Zinc finger, A20-type (IPR002653)

Expression Databases

TENOR (Os08t0436400-00)

Others

Oryzabase (18187)

Transcript

678 bp

>Os08t0436400-00 Zinc finger A20 and AN1 domain-containing stress-associated protein 12.
ATGGAGGAGCAGCAGGCGGCGGCTGCGGGCGGCGGAGGCGGCGGCGGCGGCGCGTCGATG
TGCGCGAACGGGTGCGGCTTCTTCGGCAGCGAGGCGACCAAGAAGCTCTGCTCCAAGTGC
TACCGCGACCAGCTCAAGGCGGCGCCGTCGTCGCCGCCGGCGGCGCCTGACCTCGTCGCG
AACGAGGAGGAGGAGGCGAGCACGGCCGCCGCCGCCGCCGCCGACGAGCAGCTGGCGCTG
TGCTCGAGCGGCTGCGGGTTCTTCGGCAGCAAGGAGACCAACAACATGTGCTCCAAGTGC
TACCGCGACCACCTCAAGGCGACGTCGCCGTTGTTCTCGTCGTCGTCGTCGCCGGCCACC
GCATCCACTACCGACATCACCGTCCCCATTGCTCCGGCCACCACGGCGCCGACGCCGTCG
CTCAAGGGGAAGGAGGAGGAGGCGACCGCCGCCGCGTCATCGTCGGCGGCGGCGGCGGCG
AAGCCTAACAGGTGCGTGGCGTGCCGGAAGAAGGTGGGGCTGCTGGGCTTCGAGTGCCGA
TGCGGCGGCACGTTCTGCTCGACGCACCGCCACGCCGACAAGCACGCCTGCACCTTCGAC
TTCAAGAAGAGCGACCGGGAGAAGATCGCCAAGGAGAACCCGCTGATCGTAGCGCCCAAG
ATCACCAAGTTCTGAAAA

CDS

675 bp

>Os08t0436400-00 Zinc finger A20 and AN1 domain-containing stress-associated protein 12.
ATGGAGGAGCAGCAGGCGGCGGCTGCGGGCGGCGGAGGCGGCGGCGGCGGCGCGTCGATG
TGCGCGAACGGGTGCGGCTTCTTCGGCAGCGAGGCGACCAAGAAGCTCTGCTCCAAGTGC
TACCGCGACCAGCTCAAGGCGGCGCCGTCGTCGCCGCCGGCGGCGCCTGACCTCGTCGCG
AACGAGGAGGAGGAGGCGAGCACGGCCGCCGCCGCCGCCGCCGACGAGCAGCTGGCGCTG
TGCTCGAGCGGCTGCGGGTTCTTCGGCAGCAAGGAGACCAACAACATGTGCTCCAAGTGC
TACCGCGACCACCTCAAGGCGACGTCGCCGTTGTTCTCGTCGTCGTCGTCGCCGGCCACC
GCATCCACTACCGACATCACCGTCCCCATTGCTCCGGCCACCACGGCGCCGACGCCGTCG
CTCAAGGGGAAGGAGGAGGAGGCGACCGCCGCCGCGTCATCGTCGGCGGCGGCGGCGGCG
AAGCCTAACAGGTGCGTGGCGTGCCGGAAGAAGGTGGGGCTGCTGGGCTTCGAGTGCCGA
TGCGGCGGCACGTTCTGCTCGACGCACCGCCACGCCGACAAGCACGCCTGCACCTTCGAC
TTCAAGAAGAGCGACCGGGAGAAGATCGCCAAGGAGAACCCGCTGATCGTAGCGCCCAAG
ATCACCAAGTTCTGA

Protein

225 aa

>Os08t0436400-00 Zinc finger A20 and AN1 domain-containing stress-associated protein 12.
MEEQQAAAAGGGGGGGGASMCANGCGFFGSEATKKLCSKCYRDQLKAAPSSPPAAPDLVA
NEEEEASTAAAAAADEQLALCSSGCGFFGSKETNNMCSKCYRDHLKATSPLFSSSSSPAT
ASTTDITVPIAPATTAPTPSLKGKEEEATAAASSSAAAAAKPNRCVACRKKVGLLGFECR
CGGTFCSTHRHADKHACTFDFKKSDREKIAKENPLIVAPKITKF*

CDS

chr08:21205488..21206162 (+ strand) : 675 bp

3'UTR

chr08:21206163..21206165 (+ strand) : 3 bp

FASTA

>Os08t0436400-00 class=Sequence position=chr08:21205488..21206165 (+ strand)
ATGGAGGAGC AGCAGGCGGC GGCTGCGGGC GGCGGAGGCG GCGGCGGCGG CGCGTCGATG TGCGCGAACG GGTGCGGCTT
CTTCGGCAGC GAGGCGACCA AGAAGCTCTG CTCCAAGTGC TACCGCGACC AGCTCAAGGC GGCGCCGTCG TCGCCGCCGG
CGGCGCCTGA CCTCGTCGCG AACGAGGAGG AGGAGGCGAG CACGGCCGCC GCCGCCGCCG CCGACGAGCA GCTGGCGCTG
TGCTCGAGCG GCTGCGGGTT CTTCGGCAGC AAGGAGACCA ACAACATGTG CTCCAAGTGC TACCGCGACC ACCTCAAGGC
GACGTCGCCG TTGTTCTCGT CGTCGTCGTC GCCGGCCACC GCATCCACTA CCGACATCAC CGTCCCCATT GCTCCGGCCA
CCACGGCGCC GACGCCGTCG CTCAAGGGGA AGGAGGAGGA GGCGACCGCC GCCGCGTCAT CGTCGGCGGC GGCGGCGGCG
AAGCCTAACA GGTGCGTGGC GTGCCGGAAG AAGGTGGGGC TGCTGGGCTT CGAGTGCCGA TGCGGCGGCA CGTTCTGCTC
GACGCACCGC CACGCCGACA AGCACGCCTG CACCTTCGAC TTCAAGAAGA GCGACCGGGA GAAGATCGCC AAGGAGAACC
CGCTGATCGT AGCGCCCAAG ATCACCAAGT TCTGAAAA

Locus: Os08g0436400

Loading...

Locus: Os08g0436400

Loading...