Os08t0442700-01

Locus

Os08g0442700

Description

Leucine-rich repeat receptor-like kinase, Regulation of commissural vein pattern formation

RAP-DB Gene Symbol Synonym(s)

COE1

RAP-DB Gene Name Synonym(s)

commissural vein excessive1

CGSNL Gene Symbol

COE1

CGSNL Gene Name

COMMISSURAL VEIN EXCESSIVE1

Oryzabase Gene Symbol Synonym(s)

coe1

Oryzabase Gene Name Synonym(s)

commissural vein excessive1

Transcript Evidence

AK111772

Protein Evidence

Q6Z8R5

Literature

PMID: 20487383

Note

Manual Curation

December 22, 2017

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Protein kinase-like domain superfamily (IPR011009)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Protein kinase domain (IPR000719)

Leucine-rich repeat (IPR001611)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J023067P10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0442700-01)

RiceXPro (AK111772)

Others

Oryzabase (8788)

KEGG (Os08t0442700-01)

Transcript

2670 bp

>Os08t0442700-01 Leucine-rich repeat receptor-like kinase, Regulation of commissural vein pattern formation
GACGGCTGATTGCCTGCCTGCCTCCCCTCACCCCTGCTTCTCCTTCTCCCTCCTTCTCAC
TTTTCTTCCTCTCGGGCGCCTCTCCTCTCCATCATTCCTCCCACTGCTCCGCTCCCCCAT
TCCAATGGCCTCCAACCTCTTCCTCCTCCTCTTCTTCCTCGTCGTCTCCTACGCGCCGTT
CCTCGCCTTCTCCTCCGAGCCCCTCAACCCTGAAGTGGAGGCGCTGATCGCCATCAGGCA
GGGGCTGGTCGACCCGCACGGCGTGCTGAACAACTGGGACGAGGACTCCGTCGACCCCTG
CAGCTGGGCCATGGTCACCTGCTCCGCCCACAACCTCGTCATCGGCCTGGGAGCGCCCAG
CCAGGGATTGTCGGGGACCCTGTCCGGCAGGATCGCCAACCTCACCAATCTTGAACAAGT
GCTGCTGCAGAACAACAACATCACCGGCCGGCTGCCGCCGGAGCTGGGCGCGCTGCCGAG
GCTGCAGACGCTCGACCTCTCCAACAACCGCTTCTCCGGCCGCGTCCCCGACACGCTCGG
CCGCCTCTCCACCCTCCGATACCTGAGGCTAAACAACAACAGCTTGTCCGGGGCGTTCCC
GTCGTCGCTGGCCAAGATCCCACAGCTCTCCTTCCTGGACTTGTCCTACAACAACCTCAC
TGGCCCTGTTCCTCACTTCCCCACAAGAACATTCAACGTCGTGGGCAATCCAATGATATG
CGGGAGCAGCAGCGGCAGCCATGCGGGGAACGCGAACGCAGCGGAGTGCGCCACCGTGGT
CGCCCCGGTCACCGTGCCATTCCCGCTGGACTCCACTCCGAGCAGCAGCAGCAGGGCGGC
AGCGGCAGCGGTGGGGAGGTCAAAGGGTGGAGGAGGCGCCGCGCGGTTGCCGATCGGAGT
AGGGACAAGCCTTGGCGCCTCCGCGCTTGTGCTCCTCGCCGTCTCCTGCTTTCTCTGGAG
GCGCAGGCGCCGGCACCGCTGCCTCCTCTCGGGCCCCTCCTCCGTCCTCGGCATCCTCGA
GAAGGGGAGAGACGTGGAGGATGGGGGAGGAGGGGAGGTGATGGCGAGGCTGGGGAACGT
GAGGCAGTTCGGGCTGAGGGAGCTGCACGCGGCGACGGACGGGTTCAGCGCGAGGAACAT
ACTGGGGAAAGGAGGGTTCGGGGACGTGTACCGGGGGAGGCTCTCCGACGGCACGGTCGT
GGCGGTGAAGCGGCTCAAGGACCCGACCGCGTCCGGGGAGGCGCAGTTCCGGACGGAGGT
GGAGATGATCAGCCTCGCCGTGCACCGCCACCTCCTCCGCCTCGTCGGCTTCTGCGCCGC
GGCCTCCGGCGAGCGCCTCCTCGTCTACCCCTACATGCCCAACGGCAGCGTCGCCTCCCG
CCTTCGAGggaagccgccgctggactggcagacgaggaagcggatcgcggtggggacggc
gaggggattgctgtacctgcacgagcagtgcgacccaaagatcatccaccgcgacgtgaa
ggccgcgaacgtgctgctggacgagtgccacgaggccgtcgtcggcgacttcgggctcgc
caagctgctcgaccacggcgactcccacgtcaccacggcggtgcgcggcacggtggggca
catcgcgccggagtacctctccacggggcagtcgtcggagaagaccgacgtgttcggctt
cggcatcctgctgctcgagctcgtcaccggccagcgcgcgctcgaggtcggcaagggctc
cggcgtcatccagcaccagaagggcgtcatgctcgattgggtgaggaaggtgcaccaaga
gaagctgcatgacttgctagtggaccaagatttggggcctcactacgacaggatagaggt
ggcggagatggtgcaggtggcgctgctctgcacccagttccagccgtctcaccggccgag
gatgtcggaggtggtccggatgctggagggagacgggctcgccgagaaatgggaggcCAA
CCACCGGCCGGCGGCGATGGCGGCGGCGGCGGCGCCCCATGAGCTCGGCTACGACCACCG
CAACGACTCCAACGGCTCCGTCTTCTTCAACGACTTCCACGACAACGACAGCAGCCTTAG
CAGCGACGAGGTGCGGTCCATCGACATGGTAGAGGAGATGGAGCTGTCAGGGCCAAGGTA
GCAGCAGAATGCAGCAGAGCATTCAGAGCACTGAAAAAGAAATTCAGAGAATCAGATATT
CAGGGAGAGTACTTCAGGAAAAAAAGAGAAGAAAAATATATTACAGAGGGAAGGGATTGG
ATTTGTTGCTAGCTGGAGTAGTACGAGTAGTTTCAAAGTGATTGAGATGCTTTTTAGTTT
TAGACCACAGTGTGTAGTTTCTGTCTGATCAAAGAGAGGCCCTTTCCCCGAGAAAGATGT
AAAGAAAAAGGGGCTCCTCCTCTCCGGTTTCTCTTTTGCTTCTTTTCACAGGCTTCTTTA
TCTTTTGCTGCTGCTGCTTTCTTTTCTCTCTTTCTTTTGTTGATTTGGGGACGGACATGG
CACATGCAGCGCTGCAGAAGACCTTTGGTTTGCATTCTGGCCCTGATCTCGAGCAAACTT
TTGCAGTACACCCCTGTTCATATATGTATGGGCTTCTTCTGAATTCTGAACTCCTTATCT
GTATCACTGTATGTAAGGGGAGGGATGTTG

CDS

2037 bp

>Os08t0442700-01 Leucine-rich repeat receptor-like kinase, Regulation of commissural vein pattern formation
ATGGCCTCCAACCTCTTCCTCCTCCTCTTCTTCCTCGTCGTCTCCTACGCGCCGTTCCTC
GCCTTCTCCTCCGAGCCCCTCAACCCTGAAGTGGAGGCGCTGATCGCCATCAGGCAGGGG
CTGGTCGACCCGCACGGCGTGCTGAACAACTGGGACGAGGACTCCGTCGACCCCTGCAGC
TGGGCCATGGTCACCTGCTCCGCCCACAACCTCGTCATCGGCCTGGGAGCGCCCAGCCAG
GGATTGTCGGGGACCCTGTCCGGCAGGATCGCCAACCTCACCAATCTTGAACAAGTGCTG
CTGCAGAACAACAACATCACCGGCCGGCTGCCGCCGGAGCTGGGCGCGCTGCCGAGGCTG
CAGACGCTCGACCTCTCCAACAACCGCTTCTCCGGCCGCGTCCCCGACACGCTCGGCCGC
CTCTCCACCCTCCGATACCTGAGGCTAAACAACAACAGCTTGTCCGGGGCGTTCCCGTCG
TCGCTGGCCAAGATCCCACAGCTCTCCTTCCTGGACTTGTCCTACAACAACCTCACTGGC
CCTGTTCCTCACTTCCCCACAAGAACATTCAACGTCGTGGGCAATCCAATGATATGCGGG
AGCAGCAGCGGCAGCCATGCGGGGAACGCGAACGCAGCGGAGTGCGCCACCGTGGTCGCC
CCGGTCACCGTGCCATTCCCGCTGGACTCCACTCCGAGCAGCAGCAGCAGGGCGGCAGCG
GCAGCGGTGGGGAGGTCAAAGGGTGGAGGAGGCGCCGCGCGGTTGCCGATCGGAGTAGGG
ACAAGCCTTGGCGCCTCCGCGCTTGTGCTCCTCGCCGTCTCCTGCTTTCTCTGGAGGCGC
AGGCGCCGGCACCGCTGCCTCCTCTCGGGCCCCTCCTCCGTCCTCGGCATCCTCGAGAAG
GGGAGAGACGTGGAGGATGGGGGAGGAGGGGAGGTGATGGCGAGGCTGGGGAACGTGAGG
CAGTTCGGGCTGAGGGAGCTGCACGCGGCGACGGACGGGTTCAGCGCGAGGAACATACTG
GGGAAAGGAGGGTTCGGGGACGTGTACCGGGGGAGGCTCTCCGACGGCACGGTCGTGGCG
GTGAAGCGGCTCAAGGACCCGACCGCGTCCGGGGAGGCGCAGTTCCGGACGGAGGTGGAG
ATGATCAGCCTCGCCGTGCACCGCCACCTCCTCCGCCTCGTCGGCTTCTGCGCCGCGGCC
TCCGGCGAGCGCCTCCTCGTCTACCCCTACATGCCCAACGGCAGCGTCGCCTCCCGCCTT
CGAGggaagccgccgctggactggcagacgaggaagcggatcgcggtggggacggcgagg
ggattgctgtacctgcacgagcagtgcgacccaaagatcatccaccgcgacgtgaaggcc
gcgaacgtgctgctggacgagtgccacgaggccgtcgtcggcgacttcgggctcgccaag
ctgctcgaccacggcgactcccacgtcaccacggcggtgcgcggcacggtggggcacatc
gcgccggagtacctctccacggggcagtcgtcggagaagaccgacgtgttcggcttcggc
atcctgctgctcgagctcgtcaccggccagcgcgcgctcgaggtcggcaagggctccggc
gtcatccagcaccagaagggcgtcatgctcgattgggtgaggaaggtgcaccaagagaag
ctgcatgacttgctagtggaccaagatttggggcctcactacgacaggatagaggtggcg
gagatggtgcaggtggcgctgctctgcacccagttccagccgtctcaccggccgaggatg
tcggaggtggtccggatgctggagggagacgggctcgccgagaaatgggaggcCAACCAC
CGGCCGGCGGCGATGGCGGCGGCGGCGGCGCCCCATGAGCTCGGCTACGACCACCGCAAC
GACTCCAACGGCTCCGTCTTCTTCAACGACTTCCACGACAACGACAGCAGCCTTAGCAGC
GACGAGGTGCGGTCCATCGACATGGTAGAGGAGATGGAGCTGTCAGGGCCAAGGTAG

Protein

678 aa

>Os08t0442700-01 Leucine-rich repeat receptor-like kinase, Regulation of commissural vein pattern formation
MASNLFLLLFFLVVSYAPFLAFSSEPLNPEVEALIAIRQGLVDPHGVLNNWDEDSVDPCS
WAMVTCSAHNLVIGLGAPSQGLSGTLSGRIANLTNLEQVLLQNNNITGRLPPELGALPRL
QTLDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLSYNNLTG
PVPHFPTRTFNVVGNPMICGSSSGSHAGNANAAECATVVAPVTVPFPLDSTPSSSSRAAA
AAVGRSKGGGGAARLPIGVGTSLGASALVLLAVSCFLWRRRRRHRCLLSGPSSVLGILEK
GRDVEDGGGGEVMARLGNVRQFGLRELHAATDGFSARNILGKGGFGDVYRGRLSDGTVVA
VKRLKDPTASGEAQFRTEVEMISLAVHRHLLRLVGFCAAASGERLLVYPYMPNGSVASRL
RGKPPLDWQTRKRIAVGTARGLLYLHEQCDPKIIHRDVKAANVLLDECHEAVVGDFGLAK
LLDHGDSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRALEVGKGSG
VIQHQKGVMLDWVRKVHQEKLHDLLVDQDLGPHYDRIEVAEMVQVALLCTQFQPSHRPRM
SEVVRMLEGDGLAEKWEANHRPAAMAAAAAPHELGYDHRNDSNGSVFFNDFHDNDSSLSS
DEVRSIDMVEEMELSGPR*

5'UTR

chr08:21583489..21583612 (- strand) : 124 bp

CDS

chr08:21583398..21583488 (- strand) : 91 bp

chr08:21583169..21583301 (- strand) : 133 bp

chr08:21582943..21583014 (- strand) : 72 bp

chr08:21582640..21582783 (- strand) : 144 bp

chr08:21582447..21582518 (- strand) : 72 bp

chr08:21582271..21582330 (- strand) : 60 bp

chr08:21581950..21582086 (- strand) : 137 bp

chr08:21581636..21581821 (- strand) : 186 bp

chr08:21581184..21581552 (- strand) : 369 bp

chr08:21579605..21579996 (- strand) : 392 bp

chr08:21578673..21579053 (- strand) : 381 bp

3'UTR

chr08:21578164..21578672 (- strand) : 509 bp

FASTA

>Os08t0442700-01 class=Sequence position=chr08:21578164..21583612 (- strand)
GACGGCTGAT TGCCTGCCTG CCTCCCCTCA CCCCTGCTTC TCCTTCTCCC TCCTTCTCAC TTTTCTTCCT CTCGGGCGCC
TCTCCTCTCC ATCATTCCTC CCACTGCTCC GCTCCCCCAT TCCAATGGCC TCCAACCTCT TCCTCCTCCT CTTCTTCCTC
GTCGTCTCCT ACGCGCCGTT CCTCGCCTTC TCCTCCGAGC CCCTCAACCC TGAAGGTACG TGCCCTTGTC TGACGTTTCT
TGGAACCGAA GATGGCTGCG GCTGATGAGA CCGCATGTTG GTTGTATTTG GCGCGGCGAA TGCGCGTGCA GTGGAGGCGC
TGATCGCCAT CAGGCAGGGG CTGGTCGACC CGCACGGCGT GCTGAACAAC TGGGACGAGG ACTCCGTCGA CCCCTGCAGC
TGGGCCATGG TCACCTGCTC CGCCCACAAC CTCGTCATCG GCCTGTAAGC TCGCTCTCTC TCTCTCTCTC TCTCTCTCTC
AGTCTTCGTC GTCGTCGTCT AGCTTTTGCT TGTTTTGAGC AACTTAGCGA GAGACCGGAA ATGGCAGCCG ACCGGCTCGA
TCAGCTCCAC TAATGCGTGC TTGTGTACCT CGTCTCAGGG GAGCGCCCAG CCAGGGATTG TCGGGGACCC TGTCCGGCAG
GATCGCCAAC CTCACCAATC TTGAACAAGT GTAAGCAAGA GAAAGAAACT TTTGTTTTCT TGTTTAATTG CTTCTGTTAG
AGATTCCAAT CGATTCATCT CGTGTTCTTG GGAGAAATGG AGGAGGAAGA AGCAGAGCAG AGCATCAAAT GGTGATGATG
ACGTCGTTTG TCTTCGACTT TGTTTTCAGG CTGCTGCAGA ACAACAACAT CACCGGCCGG CTGCCGCCGG AGCTGGGCGC
GCTGCCGAGG CTGCAGACGC TCGACCTCTC CAACAACCGC TTCTCCGGCC GCGTCCCCGA CACGCTCGGC CGCCTCTCCA
CCCTCCGATA CCTGTCAGTC ACTTCTCTCC CCCCAACACA TTCCATTCCA TTCCATACTT TACTACTCTA CACTAAAGCT
AAAATAGTTT AAGTTCTTCA TGGTTGTCTC ACTTGCGTGT TAATCTTGCC GCAGGAGGCT AAACAACAAC AGCTTGTCCG
GGGCGTTCCC GTCGTCGCTG GCCAAGATCC CACAGCTCTC CTTCCTGTAC GCTAATTAAT CCAACTCTGT CAAATCGTCT
CAATTCTTTT TGTCTTGCAT AGCCGATGAA CGGATCGATG TGATTGATCT TGGTATGGTT TGGTGTGCAT GCGATTTTGC
AGGGACTTGT CCTACAACAA CCTCACTGGC CCTGTTCCTC ACTTCCCCAC AAGAACATTC AAGTATGGAC TACTCCTCCC
TAGTACCACT GCTCGTGCAT TCGTCTTCTT ATTCTATTCC AGCCGCCACT AGCTATAGCT CTGTTACAAC TTATAAAATA
CTATAGAAAT ATCCCTTGGA TGTTTTCGAA TCTGATGCCG TGTTTTTTTT TCCTTTTTCA ATCATGTTAT GCGTGCACGC
ATGCAGCGTC GTGGGCAATC CAATGATATG CGGGAGCAGC AGCGGCAGCC ATGCGGGGAA CGCGAACGCA GCGGAGTGCG
CCACCGTGGT CGCCCCGGTC ACCGTGCCAT TCCCGCTGGA CTCCACTCCG AGCAGCAGCA GCAGTGAGTC CAACCTCCTC
TCGTCTTGTC TTTGCATTCT TGGGATCGAT CGGTTTGGGG GATCGGAGGG AGTTTAATCG TGTTCGTTTG GGCGTATGTG
CATGCATGCG CGGTGTACGT GTGCACTGCA GGGGCGGCAG CGGCAGCGGT GGGGAGGTCA AAGGGTGGAG GAGGCGCCGC
GCGGTTGCCG ATCGGAGTAG GGACAAGCCT TGGCGCCTCC GCGCTTGTGC TCCTCGCCGT CTCCTGCTTT CTCTGGAGGC
GCAGGCGCCG GCACCGCTGC CTCCTCTCGG GCCCCTCCTC CGTCCTCGGC ATCCTCGGTA CGCCACGTCC CCATCAACAC
CAGTACTAAA ATGCACGATC GATCAGTTAG TTAATATGTG AGTGTAATTG GTGATTTCAG AGAAGGGGAG AGACGTGGAG
GATGGGGGAG GAGGGGAGGT GATGGCGAGG CTGGGGAACG TGAGGCAGTT CGGGCTGAGG GAGCTGCACG CGGCGACGGA
CGGGTTCAGC GCGAGGAACA TACTGGGGAA AGGAGGGTTC GGGGACGTGT ACCGGGGGAG GCTCTCCGAC GGCACGGTCG
TGGCGGTGAA GCGGCTCAAG GACCCGACCG CGTCCGGGGA GGCGCAGTTC CGGACGGAGG TGGAGATGAT CAGCCTCGCC
GTGCACCGCC ACCTCCTCCG CCTCGTCGGC TTCTGCGCCG CGGCCTCCGG CGAGCGCCTC CTCGTCTACC CCTACATGCC
CAACGGCAGC GTCGCCTCCC GCCTTCGAGG TACGTTACGT ACGCTTAACG TGACACACGC AACACAGTGG TAGTGTCGAT
TTCGTGGGTG CGTGGTGTGT GGGTCCCGCG TGCGCGTTGG GGTGCACGCA GGAGTCATGG GGATGGATCA GTCGTAGTCC
CCGTCCCCCT GTGTGTCAGC GTGGTCAGGC GTGGTCGCGC CTCCACCCCG TCCTGTACTT TGCCTCCTCC CCCACGGGCC
CCACTCGCCA GGCGCCACCG CACTCACGTT TTGTCCGCTT CACCGGCGTG CGCGTCCTTC CTCGCTGCGC GGCGCAACAA
CGGCGTGCGG CTGGTTCACC GGCCGCCGCG GCTGTAGCAG TAAATTGGGC AAACATGATG ACGAGTGGTC ATCAGGGGCT
CAGGGTTGAG GTCTGGGTGT AACGCGATCA TTGCGATGGT TTTTATACAG tactacctcc gtcccaaaat aagtgtagcc
ataagtttct gtacccaact ttgattatcc gttttatttg aaattttttt ataattagta tttttgttgt tatgagatga
taaaacatga atagtacttt attcatggct tatgttttta attttttcaa aaagttttta aataagacga acggttaaag
ttagacgcgg aaaaccataa ttgtacttat tttggaacag agggagtaAC AGTAGGAGTA GTGCTGCCAC GGTGCTTGGG
GTTTTTGGAG ATCGGTGTGG TGGTCCGGGT GGGAGGGGGC CACCGGTCAG GGGAGTTGCA GGGAAACGTT TGTTTCTTCT
TTTATTCCGG CAGGGGGCCG GCCTCCTCCT CTCCCTAGCC GCAGCTGTTG CAGGGGAGGC AGCCAGCGGC AGCACAGGCT
ATACGTGCCC CAGCTACGCT ACGAGCCCGT GTGTCTGGTC GCTGTTGCCG GCTTGTTGCT GCGTGCTCGC ATGTGCCAAC
AAGTTTGTGG CATACTGTAC ACGTCGTTAT TTCAGTAGTA CGTACGTTGG CCGCGTTCGT GGTTTTTGTT CACGATGCAG
GGGGACGTAC GGGTTCTGTA TACCCTACGT ACCTTGCTGG TTCAAACATA GCAACTGTAT GCAGCATTTA TACTCACAAG
CAATTGGCGT TTTGTTGTCT TGTGCTGCGC ATTGAGAACT GAAATTGTTT GGAGCAAATT TTGTTGAAAC Atttgttacg
caaaaaattt atgaagggaa gccgccgctg gactggcaga cgaggaagcg gatcgcggtg gggacggcga ggggattgct
gtacctgcac gagcagtgcg acccaaagat catccaccgc gacgtgaagg ccgcgaacgt gctgctggac gagtgccacg
aggccgtcgt cggcgacttc gggctcgcca agctgctcga ccacggcgac tcccacgtca ccacggcggt gcgcggcacg
gtggggcaca tcgcgccgga gtacctctcc acggggcagt cgtcggagaa gaccgacgtg ttcggcttcg gcatcctgct
gctcgagctc gtcaccggcc agcgcgcgct cgaggtcggc aagggctccg gcgtcatcca gcaccagaag ggcgtcatgc
tcgattgggt aagCATGCAC TTCCACATTT CTTCTCCAAT TTTCAGCTTT TTTTAGCTGC TGTTTGAGCC GTGATCGAAA
AGATGTTGCA CTAGTTCTTG TTTGACGAAT TAAAAGCCTC GGTTGCTTTG ATCGAGCCCG TACGTGAATG TCTTTGGTAA
AGTTCGCAAA TCTTTTGCGA AAGATCCATC CAGTACACTA GCATGTGCGT TCATTGCGCG CGCGGTCACT GGCTCACTGC
ACTTTGAGGC GCTGCTCATT CAATAGCAAC TTCTAGTGAA TCTGATGCTC GAATGACAGT AGTCAGTAGG CGCCCCAACT
GTCAGTCTAA GATTAATTGC GAGTACTATG AACCTGACAT ACTAACGCAA TCCTGCAAGC ATTGCCACTG CATGTTTGAA
TGCTGATCGT CCTCCCACGT ACTGTTCACT CTGCATATGG CATGCAAATG ACTTGCTTCT GAAAAATGAC AATGTCTTCA
ACTACTTAAT CTCCATGTGT AAATGATCTG AAAATTTTCT TCTTTTTTGT TTTCGTTCGA TCGTGTTATC AAAATGAagg
tgaggaaggt gcaccaagag aagctgcatg acttgctagt ggaccaagat ttggggcctc actacgacag gatagaggtg
gcggagatgg tgcaggtggc gctgctctgc acccagttcc agccgtctca ccggccgagg atgtcggagg tggtccggat
gctggaggga gacgggctcg ccgagaaatg ggaggcCAAC CACCGGCCGG CGGCGATGGC GGCGGCGGCG GCGCCCCATG
AGCTCGGCTA CGACCACCGC AACGACTCCA ACGGCTCCGT CTTCTTCAAC GACTTCCACG ACAACGACAG CAGCCTTAGC
AGCGACGAGG TGCGGTCCAT CGACATGGTA GAGGAGATGG AGCTGTCAGG GCCAAGGTAG CAGCAGAATG CAGCAGAGCA
TTCAGAGCAC TGAAAAAGAA ATTCAGAGAA TCAGATATTC AGGGAGAGTA CTTCAGGAAA AAAAGAGAAG AAAAATATAT
TACAGAGGGA AGGGATTGGA TTTGTTGCTA GCTGGAGTAG TACGAGTAGT TTCAAAGTGA TTGAGATGCT TTTTAGTTTT
AGACCACAGT GTGTAGTTTC TGTCTGATCA AAGAGAGGCC CTTTCCCCGA GAAAGATGTA AAGAAAAAGG GGCTCCTCCT
CTCCGGTTTC TCTTTTGCTT CTTTTCACAG GCTTCTTTAT CTTTTGCTGC TGCTGCTTTC TTTTCTCTCT TTCTTTTGTT
GATTTGGGGA CGGACATGGC ACATGCAGCG CTGCAGAAGA CCTTTGGTTT GCATTCTGGC CCTGATCTCG AGCAAACTTT
TGCAGTACAC CCCTGTTCAT ATATGTATGG GCTTCTTCTG AATTCTGAAC TCCTTATCTG TATCACTGTA TGTAAGGGGA
GGGATGTTG

Locus: Os08g0442700

Loading...

Locus: Os08g0442700

Loading...