Os08t0442700-02

Locus

Os08g0442700

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

COE1

CGSNL Gene Name

COMMISSURAL VEIN EXCESSIVE1

Oryzabase Gene Symbol Synonym(s)

coe1

Oryzabase Gene Name Synonym(s)

commissural vein excessive1

Transcript Evidence

AK111984 (DDBJ, Best hit)

Protein Evidence

C6ZRM9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

001-022-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0442700-02)

RiceXPro (AK111984)

Others

Oryzabase (8788)

KEGG (Os08t0442700-02 (EC:2.7.11.1))

Transcript

2158 bp

>Os08t0442700-02 Similar to predicted protein.
ATTCCTCCCACTGCTCCGCTCCCCCATTCCAATGGCCTCCAACCTCTTCCTCCTCCTCTT
CTTCCTCGTCGTCTCCTACGCGCCGTTCCTCGCCTTCTCCTCCGAGCCCCTCAACCCTGA
AGTGGAGGCGCTGATCGCCATCAGGCAGGGGCTGGTCGACCCGCACGGCGTGCTGAACAA
CTGGGACGAGGACTCCGTCGACCCCTGCAGCTGGGCCATGGTCACCTGCTCCGCCCACAA
CCTCGTCATCGGCCTGGGAGCGCCCAGCCAGGGATTGTCGGGGACCCTGTCCGGCAGGAT
CGCCAACCTCACCAATCTTGAACAAGTGCTGCTGCAGAACAACAACATCACCGGCCGGCT
GCCGCCGGAGCTGGGCGCGCTGCCGAGGCTGCAGACGCTCGACCTCTCCAACAACCGCTT
CTCCGGCCGCGTCCCCGACACGCTCGGCCGCCTCTCCACCCTCCGATACCTGAGGCTAAA
CAACAACAGCTTGTCCGGGGCGTTCCCGTCGTCGCTGGCCAAGATCCCACAGCTCTCCTT
CCTGGACTTGTCCTACAACAACCTCACTGGCCCTGTTCCTCACTTCCCCACAAGAACATT
CAACGTCGTGGGCAATCCAATGATATGCGGGAGCAGCAGCGGCAGCCATGCGGGGAACGC
GAACGCAGCGGAGTGCGCCACCGTGGTCGCCCCGGTCACCGTGCCATTCCCGCTGGACTC
CACTCCGAGCAGCAGCAGCAggaagccgccgctggactggcagacgaggaagcggatcgc
ggtggggacggcgaggggattgctgtacctgcacgagcagtgcgacccaaagatcatcca
ccgcgacgtgaaggccgcgaacgtgctgctggacgagtgccacgaggccgtcgtcggcga
cttcgggctcgccaagctgctcgaccacggcgactcccacgtcaccacggcggtgcgcgg
cacggtggggcacatcgcgccggagtacctctccacggggcagtcgtcggagaagaccga
cgtgttcggcttcggcatcctgctgctcgagctcgtcaccggccagcgcgcgctcgaggt
cggcaagggctccggcgtcatccagcaccagaagggcgtcatgctcgattgggtgaggaa
ggtgcaccaagagaagctgcatgacttgctagtggaccaagatttggggcctcactacga
caggatagaggtggcggagatggtgcaggtggcgctgctctgcacccagttccagccgtc
tcaccggccgaggatgtcggaggtggtccggatgctggagggagacgggctcgccgagaa
atgggaggcCAACCACCGGCCGGCGGCGATGGCGGCGGCGGCGGCGCCCCATGAGCTCGG
CTACGACCACCGCAACGACTCCAACGGCTCCGTCTTCTTCAACGACTTCCACGACAACGA
CAGCAGCCTTAGCAGCGACGAGGTGCGGTCCATCGACATGGTAGAGGAGATGGAGCTGTC
AGGGCCAAGGTAGCAGCAGAATGCAGCAGAGCATTCAGAGCACTGAAAAAGAAATTCAGA
GAATCAGATATTCAGGGAGAGTACTTCAGGAAAAAAAGAGAAGAAAAATATATTACAGAG
GGAAGGGATTGGATTTGTTGCTAGCTGGAGTAGTACGAGTAGTTTCAAAGTGATTGAGAT
GCTTTTTAGTTTTAGACCACAGTGTGTAGTTTCTGTCTGATCAAAGAGAGGCCCTTTCCC
CGAGAAAGATGTAAAGAAAAAGGGGCTCCTCCTCTCCGGTTTCTCTTTTGCTTCTTTTCA
CAGGCTTCTTTATCTTTTGCTGCTGCTGCTTTCTTTTCTCTCTTTCTTTTGTTGATTTGG
GGACGGACATGGCACATGCAGCGCTGCAGAAGACCTTTGGTTTGCATTCTGGCCCTGATC
TCGAGCAAACTTTTGCAGTACACCCCTGTTCATATATGTATGGGCTTCTTCTGAATTCTG
AACTCCTTATCTGTATCACTGTATGTAAGGGGAGGGATGTTGATAGAGCCTTGAGAGAGA
CATGGAGTCATTTTGACTGCTTTGTGACCTGTAAAGATAATCACTCCATTTCTTTTTGTA
TGTGCAACAGTAAATGATCGAATCTGATAGTGGGAATGTTGGATGCATTGTTCTCACG

CDS

1482 bp

>Os08t0442700-02 Similar to predicted protein.
ATGGCCTCCAACCTCTTCCTCCTCCTCTTCTTCCTCGTCGTCTCCTACGCGCCGTTCCTC
GCCTTCTCCTCCGAGCCCCTCAACCCTGAAGTGGAGGCGCTGATCGCCATCAGGCAGGGG
CTGGTCGACCCGCACGGCGTGCTGAACAACTGGGACGAGGACTCCGTCGACCCCTGCAGC
TGGGCCATGGTCACCTGCTCCGCCCACAACCTCGTCATCGGCCTGGGAGCGCCCAGCCAG
GGATTGTCGGGGACCCTGTCCGGCAGGATCGCCAACCTCACCAATCTTGAACAAGTGCTG
CTGCAGAACAACAACATCACCGGCCGGCTGCCGCCGGAGCTGGGCGCGCTGCCGAGGCTG
CAGACGCTCGACCTCTCCAACAACCGCTTCTCCGGCCGCGTCCCCGACACGCTCGGCCGC
CTCTCCACCCTCCGATACCTGAGGCTAAACAACAACAGCTTGTCCGGGGCGTTCCCGTCG
TCGCTGGCCAAGATCCCACAGCTCTCCTTCCTGGACTTGTCCTACAACAACCTCACTGGC
CCTGTTCCTCACTTCCCCACAAGAACATTCAACGTCGTGGGCAATCCAATGATATGCGGG
AGCAGCAGCGGCAGCCATGCGGGGAACGCGAACGCAGCGGAGTGCGCCACCGTGGTCGCC
CCGGTCACCGTGCCATTCCCGCTGGACTCCACTCCGAGCAGCAGCAGCAggaagccgccg
ctggactggcagacgaggaagcggatcgcggtggggacggcgaggggattgctgtacctg
cacgagcagtgcgacccaaagatcatccaccgcgacgtgaaggccgcgaacgtgctgctg
gacgagtgccacgaggccgtcgtcggcgacttcgggctcgccaagctgctcgaccacggc
gactcccacgtcaccacggcggtgcgcggcacggtggggcacatcgcgccggagtacctc
tccacggggcagtcgtcggagaagaccgacgtgttcggcttcggcatcctgctgctcgag
ctcgtcaccggccagcgcgcgctcgaggtcggcaagggctccggcgtcatccagcaccag
aagggcgtcatgctcgattgggtgaggaaggtgcaccaagagaagctgcatgacttgcta
gtggaccaagatttggggcctcactacgacaggatagaggtggcggagatggtgcaggtg
gcgctgctctgcacccagttccagccgtctcaccggccgaggatgtcggaggtggtccgg
atgctggagggagacgggctcgccgagaaatgggaggcCAACCACCGGCCGGCGGCGATG
GCGGCGGCGGCGGCGCCCCATGAGCTCGGCTACGACCACCGCAACGACTCCAACGGCTCC
GTCTTCTTCAACGACTTCCACGACAACGACAGCAGCCTTAGCAGCGACGAGGTGCGGTCC
ATCGACATGGTAGAGGAGATGGAGCTGTCAGGGCCAAGGTAG

Protein

493 aa

>Os08t0442700-02 Similar to predicted protein.
MASNLFLLLFFLVVSYAPFLAFSSEPLNPEVEALIAIRQGLVDPHGVLNNWDEDSVDPCS
WAMVTCSAHNLVIGLGAPSQGLSGTLSGRIANLTNLEQVLLQNNNITGRLPPELGALPRL
QTLDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLSYNNLTG
PVPHFPTRTFNVVGNPMICGSSSGSHAGNANAAECATVVAPVTVPFPLDSTPSSSSRKPP
LDWQTRKRIAVGTARGLLYLHEQCDPKIIHRDVKAANVLLDECHEAVVGDFGLAKLLDHG
DSHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELVTGQRALEVGKGSGVIQHQ
KGVMLDWVRKVHQEKLHDLLVDQDLGPHYDRIEVAEMVQVALLCTQFQPSHRPRMSEVVR
MLEGDGLAEKWEANHRPAAMAAAAAPHELGYDHRNDSNGSVFFNDFHDNDSSLSSDEVRS
IDMVEEMELSGPR*

5'UTR

chr08:21583489..21583519 (- strand) : 31 bp

CDS

chr08:21583398..21583488 (- strand) : 91 bp

chr08:21583169..21583301 (- strand) : 133 bp

chr08:21582943..21583014 (- strand) : 72 bp

chr08:21582640..21582783 (- strand) : 144 bp

chr08:21582447..21582518 (- strand) : 72 bp

chr08:21582271..21582330 (- strand) : 60 bp

chr08:21581950..21582086 (- strand) : 137 bp

chr08:21579605..21579996 (- strand) : 392 bp

chr08:21578673..21579053 (- strand) : 381 bp

3'UTR

chr08:21578028..21578672 (- strand) : 645 bp

FASTA

>Os08t0442700-02 class=Sequence position=chr08:21578028..21583519 (- strand)
ATTCCTCCCA CTGCTCCGCT CCCCCATTCC AATGGCCTCC AACCTCTTCC TCCTCCTCTT CTTCCTCGTC GTCTCCTACG
CGCCGTTCCT CGCCTTCTCC TCCGAGCCCC TCAACCCTGA AGGTACGTGC CCTTGTCTGA CGTTTCTTGG AACCGAAGAT
GGCTGCGGCT GATGAGACCG CATGTTGGTT GTATTTGGCG CGGCGAATGC GCGTGCAGTG GAGGCGCTGA TCGCCATCAG
GCAGGGGCTG GTCGACCCGC ACGGCGTGCT GAACAACTGG GACGAGGACT CCGTCGACCC CTGCAGCTGG GCCATGGTCA
CCTGCTCCGC CCACAACCTC GTCATCGGCC TGTAAGCTCG CTCTCTCTCT CTCTCTCTCT CTCTCTCAGT CTTCGTCGTC
GTCGTCTAGC TTTTGCTTGT TTTGAGCAAC TTAGCGAGAG ACCGGAAATG GCAGCCGACC GGCTCGATCA GCTCCACTAA
TGCGTGCTTG TGTACCTCGT CTCAGGGGAG CGCCCAGCCA GGGATTGTCG GGGACCCTGT CCGGCAGGAT CGCCAACCTC
ACCAATCTTG AACAAGTGTA AGCAAGAGAA AGAAACTTTT GTTTTCTTGT TTAATTGCTT CTGTTAGAGA TTCCAATCGA
TTCATCTCGT GTTCTTGGGA GAAATGGAGG AGGAAGAAGC AGAGCAGAGC ATCAAATGGT GATGATGACG TCGTTTGTCT
TCGACTTTGT TTTCAGGCTG CTGCAGAACA ACAACATCAC CGGCCGGCTG CCGCCGGAGC TGGGCGCGCT GCCGAGGCTG
CAGACGCTCG ACCTCTCCAA CAACCGCTTC TCCGGCCGCG TCCCCGACAC GCTCGGCCGC CTCTCCACCC TCCGATACCT
GTCAGTCACT TCTCTCCCCC CAACACATTC CATTCCATTC CATACTTTAC TACTCTACAC TAAAGCTAAA ATAGTTTAAG
TTCTTCATGG TTGTCTCACT TGCGTGTTAA TCTTGCCGCA GGAGGCTAAA CAACAACAGC TTGTCCGGGG CGTTCCCGTC
GTCGCTGGCC AAGATCCCAC AGCTCTCCTT CCTGTACGCT AATTAATCCA ACTCTGTCAA ATCGTCTCAA TTCTTTTTGT
CTTGCATAGC CGATGAACGG ATCGATGTGA TTGATCTTGG TATGGTTTGG TGTGCATGCG ATTTTGCAGG GACTTGTCCT
ACAACAACCT CACTGGCCCT GTTCCTCACT TCCCCACAAG AACATTCAAG TATGGACTAC TCCTCCCTAG TACCACTGCT
CGTGCATTCG TCTTCTTATT CTATTCCAGC CGCCACTAGC TATAGCTCTG TTACAACTTA TAAAATACTA TAGAAATATC
CCTTGGATGT TTTCGAATCT GATGCCGTGT TTTTTTTTCC TTTTTCAATC ATGTTATGCG TGCACGCATG CAGCGTCGTG
GGCAATCCAA TGATATGCGG GAGCAGCAGC GGCAGCCATG CGGGGAACGC GAACGCAGCG GAGTGCGCCA CCGTGGTCGC
CCCGGTCACC GTGCCATTCC CGCTGGACTC CACTCCGAGC AGCAGCAGCA GTGAGTCCAA CCTCCTCTCG TCTTGTCTTT
GCATTCTTGG GATCGATCGG TTTGGGGGAT CGGAGGGAGT TTAATCGTGT TCGTTTGGGC GTATGTGCAT GCATGCGCGG
TGTACGTGTG CACTGCAGGG GCGGCAGCGG CAGCGGTGGG GAGGTCAAAG GGTGGAGGAG GCGCCGCGCG GTTGCCGATC
GGAGTAGGGA CAAGCCTTGG CGCCTCCGCG CTTGTGCTCC TCGCCGTCTC CTGCTTTCTC TGGAGGCGCA GGCGCCGGCA
CCGCTGCCTC CTCTCGGGCC CCTCCTCCGT CCTCGGCATC CTCGGTACGC CACGTCCCCA TCAACACCAG TACTAAAATG
CACGATCGAT CAGTTAGTTA ATATGTGAGT GTAATTGGTG ATTTCAGAGA AGGGGAGAGA CGTGGAGGAT GGGGGAGGAG
GGGAGGTGAT GGCGAGGCTG GGGAACGTGA GGCAGTTCGG GCTGAGGGAG CTGCACGCGG CGACGGACGG GTTCAGCGCG
AGGAACATAC TGGGGAAAGG AGGGTTCGGG GACGTGTACC GGGGGAGGCT CTCCGACGGC ACGGTCGTGG CGGTGAAGCG
GCTCAAGGAC CCGACCGCGT CCGGGGAGGC GCAGTTCCGG ACGGAGGTGG AGATGATCAG CCTCGCCGTG CACCGCCACC
TCCTCCGCCT CGTCGGCTTC TGCGCCGCGG CCTCCGGCGA GCGCCTCCTC GTCTACCCCT ACATGCCCAA CGGCAGCGTC
GCCTCCCGCC TTCGAGGTAC GTTACGTACG CTTAACGTGA CACACGCAAC ACAGTGGTAG TGTCGATTTC GTGGGTGCGT
GGTGTGTGGG TCCCGCGTGC GCGTTGGGGT GCACGCAGGA GTCATGGGGA TGGATCAGTC GTAGTCCCCG TCCCCCTGTG
TGTCAGCGTG GTCAGGCGTG GTCGCGCCTC CACCCCGTCC TGTACTTTGC CTCCTCCCCC ACGGGCCCCA CTCGCCAGGC
GCCACCGCAC TCACGTTTTG TCCGCTTCAC CGGCGTGCGC GTCCTTCCTC GCTGCGCGGC GCAACAACGG CGTGCGGCTG
GTTCACCGGC CGCCGCGGCT GTAGCAGTAA ATTGGGCAAA CATGATGACG AGTGGTCATC AGGGGCTCAG GGTTGAGGTC
TGGGTGTAAC GCGATCATTG CGATGGTTTT TATACAGtac tacctccgtc ccaaaataag tgtagccata agtttctgta
cccaactttg attatccgtt ttatttgaaa tttttttata attagtattt ttgttgttat gagatgataa aacatgaata
gtactttatt catggcttat gtttttaatt ttttcaaaaa gtttttaaat aagacgaacg gttaaagtta gacgcggaaa
accataattg tacttatttt ggaacagagg gagtaACAGT AGGAGTAGTG CTGCCACGGT GCTTGGGGTT TTTGGAGATC
GGTGTGGTGG TCCGGGTGGG AGGGGGCCAC CGGTCAGGGG AGTTGCAGGG AAACGTTTGT TTCTTCTTTT ATTCCGGCAG
GGGGCCGGCC TCCTCCTCTC CCTAGCCGCA GCTGTTGCAG GGGAGGCAGC CAGCGGCAGC ACAGGCTATA CGTGCCCCAG
CTACGCTACG AGCCCGTGTG TCTGGTCGCT GTTGCCGGCT TGTTGCTGCG TGCTCGCATG TGCCAACAAG TTTGTGGCAT
ACTGTACACG TCGTTATTTC AGTAGTACGT ACGTTGGCCG CGTTCGTGGT TTTTGTTCAC GATGCAGGGG GACGTACGGG
TTCTGTATAC CCTACGTACC TTGCTGGTTC AAACATAGCA ACTGTATGCA GCATTTATAC TCACAAGCAA TTGGCGTTTT
GTTGTCTTGT GCTGCGCATT GAGAACTGAA ATTGTTTGGA GCAAATTTTG TTGAAACAtt tgttacgcaa aaaatttatg
aagggaagcc gccgctggac tggcagacga ggaagcggat cgcggtgggg acggcgaggg gattgctgta cctgcacgag
cagtgcgacc caaagatcat ccaccgcgac gtgaaggccg cgaacgtgct gctggacgag tgccacgagg ccgtcgtcgg
cgacttcggg ctcgccaagc tgctcgacca cggcgactcc cacgtcacca cggcggtgcg cggcacggtg gggcacatcg
cgccggagta cctctccacg gggcagtcgt cggagaagac cgacgtgttc ggcttcggca tcctgctgct cgagctcgtc
accggccagc gcgcgctcga ggtcggcaag ggctccggcg tcatccagca ccagaagggc gtcatgctcg attgggtaag
CATGCACTTC CACATTTCTT CTCCAATTTT CAGCTTTTTT TAGCTGCTGT TTGAGCCGTG ATCGAAAAGA TGTTGCACTA
GTTCTTGTTT GACGAATTAA AAGCCTCGGT TGCTTTGATC GAGCCCGTAC GTGAATGTCT TTGGTAAAGT TCGCAAATCT
TTTGCGAAAG ATCCATCCAG TACACTAGCA TGTGCGTTCA TTGCGCGCGC GGTCACTGGC TCACTGCACT TTGAGGCGCT
GCTCATTCAA TAGCAACTTC TAGTGAATCT GATGCTCGAA TGACAGTAGT CAGTAGGCGC CCCAACTGTC AGTCTAAGAT
TAATTGCGAG TACTATGAAC CTGACATACT AACGCAATCC TGCAAGCATT GCCACTGCAT GTTTGAATGC TGATCGTCCT
CCCACGTACT GTTCACTCTG CATATGGCAT GCAAATGACT TGCTTCTGAA AAATGACAAT GTCTTCAACT ACTTAATCTC
CATGTGTAAA TGATCTGAAA ATTTTCTTCT TTTTTGTTTT CGTTCGATCG TGTTATCAAA ATGAaggtga ggaaggtgca
ccaagagaag ctgcatgact tgctagtgga ccaagatttg gggcctcact acgacaggat agaggtggcg gagatggtgc
aggtggcgct gctctgcacc cagttccagc cgtctcaccg gccgaggatg tcggaggtgg tccggatgct ggagggagac
gggctcgccg agaaatggga ggcCAACCAC CGGCCGGCGG CGATGGCGGC GGCGGCGGCG CCCCATGAGC TCGGCTACGA
CCACCGCAAC GACTCCAACG GCTCCGTCTT CTTCAACGAC TTCCACGACA ACGACAGCAG CCTTAGCAGC GACGAGGTGC
GGTCCATCGA CATGGTAGAG GAGATGGAGC TGTCAGGGCC AAGGTAGCAG CAGAATGCAG CAGAGCATTC AGAGCACTGA
AAAAGAAATT CAGAGAATCA GATATTCAGG GAGAGTACTT CAGGAAAAAA AGAGAAGAAA AATATATTAC AGAGGGAAGG
GATTGGATTT GTTGCTAGCT GGAGTAGTAC GAGTAGTTTC AAAGTGATTG AGATGCTTTT TAGTTTTAGA CCACAGTGTG
TAGTTTCTGT CTGATCAAAG AGAGGCCCTT TCCCCGAGAA AGATGTAAAG AAAAAGGGGC TCCTCCTCTC CGGTTTCTCT
TTTGCTTCTT TTCACAGGCT TCTTTATCTT TTGCTGCTGC TGCTTTCTTT TCTCTCTTTC TTTTGTTGAT TTGGGGACGG
ACATGGCACA TGCAGCGCTG CAGAAGACCT TTGGTTTGCA TTCTGGCCCT GATCTCGAGC AAACTTTTGC AGTACACCCC
TGTTCATATA TGTATGGGCT TCTTCTGAAT TCTGAACTCC TTATCTGTAT CACTGTATGT AAGGGGAGGG ATGTTGATAG
AGCCTTGAGA GAGACATGGA GTCATTTTGA CTGCTTTGTG ACCTGTAAAG ATAATCACTC CATTTCTTTT TGTATGTGCA
ACAGTAAATG ATCGAATCTG ATAGTGGGAA TGTTGGATGC ATTGTTCTCA CG

Locus: Os08g0442700

Loading...

Locus: Os08g0442700

Loading...