Os08t0452500-02

Locus

Os08g0452500

Description

Auxin responsive SAUR protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAUR33

CGSNL Gene Name

SMALL AUXIN-UP RNA 33

Oryzabase Gene Symbol Synonym(s)

OsSAUR33

Oryzabase Gene Name Synonym(s)

Small auxin-up RNA 33

Transcript Evidence

AK102438 (DDBJ, Best hit)

Protein Evidence

B6TUQ7 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Auxin responsive SAUR protein (IPR003676)

Full-length cDNA

J033093K08 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0452500-02)

RiceXPro (AK102438)

Others

Oryzabase (9158)

KEGG (Os08t0452500-02)

Transcript

868 bp

>Os08t0452500-02 Auxin responsive SAUR protein family protein.
GCTGTCTTTCTCTATCTAGCGGGTCGCGGTGAGTCGTCGTCGTCGTCGCCGGCGATGGGG
AAGGGAGGCGGGCTGAGCAAGCTGAGGTGCATGATCAGGAGGTGGCACTCGTCGAGCCGC
ATCGCGCGGGCGCCGCCGTCGGCGGGGGAGCTGGAGGAGGGCTCTGCGGCGGCGGCGGGG
AGGGCGGCGTCGTTCCACGGCGCGGACGAGGTGCCCAAGGGGCTCCACCCGGTGTACGTC
GGCAAGTCGCGGCGGCGGTACCTCATCGCCGAGGAGCTCGTCGGCCACCCGCTGTTCCAG
AACCTCGTCGACCGCACCGGCGGCGGCGGCGGCGGCGGCGCCGCGACCGTCGTCGGCTGC
GAGGTCGTGCTGTTCGAGCACCTGCTCTGGATGCTGGAGAACGCCGACCCGCAGCCGGAG
TCCCTCGACGAGCTCGTCGAGTACTACGCCTGCTGAGAAAGGCCGCCGCGCCGCGCCGCG
CGGCTTACCTCCCCCCACCACCACCGGCCGTGACGGCGGCGGCGACGCGCCGGAGTTGGA
AGCTTCCAGAAGCTGCGGTAAAATCTTTCGAAAAAAAAAATCTGTGTTTTGGTAGGGGTA
GAAGTGAAATTTCGGACGCCGGGGTCGAAGTGAAGAGTACGAAGCGGCAGCTAGCGTTTT
TTTTTTACTTAACCCCGGCGTCGGTGCTAATTGGGGAATTTACCATTTGTTACTGTGCTG
TTAATTCTCTGATCGTTCATGTATTAGCTATTGGGTTTCTCATTATTTCTTTATTTTGCC
CCAAAATAAGATCTATGGGCAAACATGCCCATCGGTCCAATGTACATTCCAGTGTAAAAA
ATTATCATGTAATTGCCGAGTTAATTTG

CDS

402 bp

>Os08t0452500-02 Auxin responsive SAUR protein family protein.
ATGGGGAAGGGAGGCGGGCTGAGCAAGCTGAGGTGCATGATCAGGAGGTGGCACTCGTCG
AGCCGCATCGCGCGGGCGCCGCCGTCGGCGGGGGAGCTGGAGGAGGGCTCTGCGGCGGCG
GCGGGGAGGGCGGCGTCGTTCCACGGCGCGGACGAGGTGCCCAAGGGGCTCCACCCGGTG
TACGTCGGCAAGTCGCGGCGGCGGTACCTCATCGCCGAGGAGCTCGTCGGCCACCCGCTG
TTCCAGAACCTCGTCGACCGCACCGGCGGCGGCGGCGGCGGCGGCGCCGCGACCGTCGTC
GGCTGCGAGGTCGTGCTGTTCGAGCACCTGCTCTGGATGCTGGAGAACGCCGACCCGCAG
CCGGAGTCCCTCGACGAGCTCGTCGAGTACTACGCCTGCTGA

Protein

133 aa

>Os08t0452500-02 Auxin responsive SAUR protein family protein.
MGKGGGLSKLRCMIRRWHSSSRIARAPPSAGELEEGSAAAAGRAASFHGADEVPKGLHPV
YVGKSRRRYLIAEELVGHPLFQNLVDRTGGGGGGGAATVVGCEVVLFEHLLWMLENADPQ
PESLDELVEYYAC*

5'UTR

chr08:22136836..22136889 (+ strand) : 54 bp

CDS

chr08:22136890..22137291 (+ strand) : 402 bp

3'UTR

chr08:22137292..22137703 (+ strand) : 412 bp

FASTA

>Os08t0452500-02 class=Sequence position=chr08:22136836..22137703 (+ strand)
GCTGTCTTTC TCTATCTAGC GGGTCGCGGT GAGTCGTCGT CGTCGTCGCC GGCGATGGGG AAGGGAGGCG GGCTGAGCAA
GCTGAGGTGC ATGATCAGGA GGTGGCACTC GTCGAGCCGC ATCGCGCGGG CGCCGCCGTC GGCGGGGGAG CTGGAGGAGG
GCTCTGCGGC GGCGGCGGGG AGGGCGGCGT CGTTCCACGG CGCGGACGAG GTGCCCAAGG GGCTCCACCC GGTGTACGTC
GGCAAGTCGC GGCGGCGGTA CCTCATCGCC GAGGAGCTCG TCGGCCACCC GCTGTTCCAG AACCTCGTCG ACCGCACCGG
CGGCGGCGGC GGCGGCGGCG CCGCGACCGT CGTCGGCTGC GAGGTCGTGC TGTTCGAGCA CCTGCTCTGG ATGCTGGAGA
ACGCCGACCC GCAGCCGGAG TCCCTCGACG AGCTCGTCGA GTACTACGCC TGCTGAGAAA GGCCGCCGCG CCGCGCCGCG
CGGCTTACCT CCCCCCACCA CCACCGGCCG TGACGGCGGC GGCGACGCGC CGGAGTTGGA AGCTTCCAGA AGCTGCGGTA
AAATCTTTCG AAAAAAAAAA TCTGTGTTTT GGTAGGGGTA GAAGTGAAAT TTCGGACGCC GGGGTCGAAG TGAAGAGTAC
GAAGCGGCAG CTAGCGTTTT TTTTTTACTT AACCCCGGCG TCGGTGCTAA TTGGGGAATT TACCATTTGT TACTGTGCTG
TTAATTCTCT GATCGTTCAT GTATTAGCTA TTGGGTTTCT CATTATTTCT TTATTTTGCC CCAAAATAAG ATCTATGGGC
AAACATGCCC ATCGGTCCAA TGTACATTCC AGTGTAAAAA ATTATCATGT AATTGCCGAG TTAATTTG

Locus: Os08g0452500

Loading...

Locus: Os08g0452500

Loading...