Os08t0454000-01

Locus

Os08g0454000

Description

Drought-responsive ethylene response factor, Transcriptional activator, Drought response through controlling the ethylene synthesis

RAP-DB Gene Symbol Synonym(s)

ERF12, OsERF#012, OsERF012, OsERF12, OsDERF1, DERF1, AP2/EREBP#070, AP2/EREBP70

RAP-DB Gene Name Synonym(s)

ETHYLENE RESPONSE FACTOR 12, ethylene response factor 12, drought-responsive ethylene response factor 1, drought-responsive ERF 1, APETALA2/ethylene-responsive element binding protein 70

CGSNL Gene Symbol

ERF12

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 12

Oryzabase Gene Symbol Synonym(s)

OsERF#012, OsERF012, OsERF12, OsDERF1, DERF1, AP2/EREBP#070, AP2/EREBP70

Oryzabase Gene Name Synonym(s)

ethylene response factor 12, drought-responsive ethylene response factor 1, drought-responsive ERF 1, APETALA2/ethylene-responsive element binding protein 70

Transcript Evidence

Inferred from literature

Protein Evidence

Q6ZAG1

Literature

PMID: 21966459

Note

Manual Curation

November 20, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

DNA-binding domain (IPR016177)

AP2/ERF domain (IPR001471)

Expression Databases

TENOR (Os08t0454000-00)

Others

Oryzabase (9687)

Transcript

747 bp

>Os08t0454000-01 Drought-responsive ethylene response factor, Transcriptional activator, Drought response through controlling the ethylene synthesis
CGAGCTTAGCTAGCCATGGATCATATTGGAATTAGCGGCGGCGGCGAGGGCGGGGTGGTG
TCTCCGGCGCAGCCGTCGTCGCCGGAGCGGCGGTACAAGggcgtgcggctgcggaagtgg
gggcggtgggtgtcggagatccggatgcccaacagccgggagaggatatggctgggctcg
tacgagtccgccgagaaggcggcgcgggcgttcgacgccgccgccgtctgcctccgcggc
tcgcgcggcgccggctcgctcaacttcccggagtccccCCCTCCCGACGTCCGCCGCCGC
TTCCCCGGCGCGGCTCTCACGGTCGAGCAGATCCAGGCCGAGGCGGCGAGGCACGCCAAC
CGCCCGTTTCCGGCGAACACCGCCGCCGCCGGCGGGTCGTCGTCGTCGTACTCGATCTCG
CAGCGGCAAGAAGCAGCAGCCCCTGCGCGGTCGACGAGCAACGACGACACGGCCATGTCG
TCAGTGCCCTCCACCGACGGCGGCGCTGCCGACTACGACGGCGGTGATGATGTCATTGAC
TGGTCATTCATGGACACGTTGCCGGCGATGTCGTCGTCAGCGGCTAGTACCAATGCTGAT
CTGGTCCCGGCCATGGATGATTTCATGTACGGGTTCTTGCACACAATGCCGCCATCGCCA
TGCGAAGACGGTGGGGAGGATGTGATGATCGACGGCAATTGCAACATGGATCAGACATTT
TTCTCAGTAGATCTTTGGAGATTTTGA

CDS

732 bp

>Os08t0454000-01 Drought-responsive ethylene response factor, Transcriptional activator, Drought response through controlling the ethylene synthesis
ATGGATCATATTGGAATTAGCGGCGGCGGCGAGGGCGGGGTGGTGTCTCCGGCGCAGCCG
TCGTCGCCGGAGCGGCGGTACAAGggcgtgcggctgcggaagtgggggcggtgggtgtcg
gagatccggatgcccaacagccgggagaggatatggctgggctcgtacgagtccgccgag
aaggcggcgcgggcgttcgacgccgccgccgtctgcctccgcggctcgcgcggcgccggc
tcgctcaacttcccggagtccccCCCTCCCGACGTCCGCCGCCGCTTCCCCGGCGCGGCT
CTCACGGTCGAGCAGATCCAGGCCGAGGCGGCGAGGCACGCCAACCGCCCGTTTCCGGCG
AACACCGCCGCCGCCGGCGGGTCGTCGTCGTCGTACTCGATCTCGCAGCGGCAAGAAGCA
GCAGCCCCTGCGCGGTCGACGAGCAACGACGACACGGCCATGTCGTCAGTGCCCTCCACC
GACGGCGGCGCTGCCGACTACGACGGCGGTGATGATGTCATTGACTGGTCATTCATGGAC
ACGTTGCCGGCGATGTCGTCGTCAGCGGCTAGTACCAATGCTGATCTGGTCCCGGCCATG
GATGATTTCATGTACGGGTTCTTGCACACAATGCCGCCATCGCCATGCGAAGACGGTGGG
GAGGATGTGATGATCGACGGCAATTGCAACATGGATCAGACATTTTTCTCAGTAGATCTT
TGGAGATTTTGA

Protein

244 aa

>Os08t0454000-01 Drought-responsive ethylene response factor, Transcriptional activator, Drought response through controlling the ethylene synthesis
MDHIGISGGGEGGVVSPAQPSSPERRYKGVRLRKWGRWVSEIRMPNSRERIWLGSYESAE
KAARAFDAAAVCLRGSRGAGSLNFPESPPPDVRRRFPGAALTVEQIQAEAARHANRPFPA
NTAAAGGSSSSYSISQRQEAAAPARSTSNDDTAMSSVPSTDGGAADYDGGDDVIDWSFMD
TLPAMSSSAASTNADLVPAMDDFMYGFLHTMPPSPCEDGGEDVMIDGNCNMDQTFFSVDL
WRF*

5'UTR

chr08:22236504..22236518 (+ strand) : 15 bp

CDS

chr08:22236519..22237250 (+ strand) : 732 bp

FASTA

>Os08t0454000-01 class=Sequence position=chr08:22236504..22237250 (+ strand)
CGAGCTTAGC TAGCCATGGA TCATATTGGA ATTAGCGGCG GCGGCGAGGG CGGGGTGGTG TCTCCGGCGC AGCCGTCGTC
GCCGGAGCGG CGGTACAAGg gcgtgcggct gcggaagtgg gggcggtggg tgtcggagat ccggatgccc aacagccggg
agaggatatg gctgggctcg tacgagtccg ccgagaaggc ggcgcgggcg ttcgacgccg ccgccgtctg cctccgcggc
tcgcgcggcg ccggctcgct caacttcccg gagtccccCC CTCCCGACGT CCGCCGCCGC TTCCCCGGCG CGGCTCTCAC
GGTCGAGCAG ATCCAGGCCG AGGCGGCGAG GCACGCCAAC CGCCCGTTTC CGGCGAACAC CGCCGCCGCC GGCGGGTCGT
CGTCGTCGTA CTCGATCTCG CAGCGGCAAG AAGCAGCAGC CCCTGCGCGG TCGACGAGCA ACGACGACAC GGCCATGTCG
TCAGTGCCCT CCACCGACGG CGGCGCTGCC GACTACGACG GCGGTGATGA TGTCATTGAC TGGTCATTCA TGGACACGTT
GCCGGCGATG TCGTCGTCAG CGGCTAGTAC CAATGCTGAT CTGGTCCCGG CCATGGATGA TTTCATGTAC GGGTTCTTGC
ACACAATGCC GCCATCGCCA TGCGAAGACG GTGGGGAGGA TGTGATGATC GACGGCAATT GCAACATGGA TCAGACATTT
TTCTCAGTAG ATCTTTGGAG ATTTTGA

Locus: Os08g0454000

Loading...

Locus: Os08g0454000

Loading...