Os08t0458400-00

Locus

Os08g0458400

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RR31

CGSNL Gene Name

B-TYPE RESPONSE REGULATOR 31

Oryzabase Gene Symbol Synonym(s)

OsRR31

Oryzabase Gene Name Synonym(s)

response regulator 31

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os08t0458400-00)

Others

Oryzabase (9833)

Transcript

648 bp

>Os08t0458400-00
ATGCGTAACCACATCAACATAGTCCCGGCGGCCTTCACGCCTCAGGACGGGATGACAATG
AATAAAGACAAGGCTCCTATGATCGAGCTTCCATTTGGGCTACCCGTGGATGACTTCCTC
GTTGGACAAACCGCATATGGCAGTGCCGGACCATCCATAGGAGCCCCTGACGACAACGAC
GATGACGCCGCCATGTACGCCTACACAAGCGCACTGAACAACAATGCAGCTGTTGGTTCT
CTCATGGTGCCACCAATTGAGTCAACATTCACCATCATCGATCCAATCGTTGGGACCAAG
GGTGAGGGATCTGTCCCTGTTGTCGTTGTGTCAGAGGATCAGAATAATGCGGTGGCAGCA
ATTGAAGCAACAGCACCTAACAACGCAGAACTATTCATGATGCCTGAACAGGTTGCTGTT
GATGCTCCGGTTGATGTTGAAGAAGGCATCATGTTCTCTCTGGAATCGCTCTTGGGGTTG
GACGAGGACATGATACCTATGGAAGACGCTGGCGGTGAGGCAACTGACGACTCACTGAAC
ATAAAGGAAGGTGGCATGGAGATCGGCTGGGACCTGGACCTGGACTACATCCTTATGAAC
AACACCAATGAATTTGCCTTCCTGGATGACATGGCCTGGATCGAGTAG

CDS

648 bp

>Os08t0458400-00
ATGCGTAACCACATCAACATAGTCCCGGCGGCCTTCACGCCTCAGGACGGGATGACAATG
AATAAAGACAAGGCTCCTATGATCGAGCTTCCATTTGGGCTACCCGTGGATGACTTCCTC
GTTGGACAAACCGCATATGGCAGTGCCGGACCATCCATAGGAGCCCCTGACGACAACGAC
GATGACGCCGCCATGTACGCCTACACAAGCGCACTGAACAACAATGCAGCTGTTGGTTCT
CTCATGGTGCCACCAATTGAGTCAACATTCACCATCATCGATCCAATCGTTGGGACCAAG
GGTGAGGGATCTGTCCCTGTTGTCGTTGTGTCAGAGGATCAGAATAATGCGGTGGCAGCA
ATTGAAGCAACAGCACCTAACAACGCAGAACTATTCATGATGCCTGAACAGGTTGCTGTT
GATGCTCCGGTTGATGTTGAAGAAGGCATCATGTTCTCTCTGGAATCGCTCTTGGGGTTG
GACGAGGACATGATACCTATGGAAGACGCTGGCGGTGAGGCAACTGACGACTCACTGAAC
ATAAAGGAAGGTGGCATGGAGATCGGCTGGGACCTGGACCTGGACTACATCCTTATGAAC
AACACCAATGAATTTGCCTTCCTGGATGACATGGCCTGGATCGAGTAG

Protein

216 aa

>Os08t0458400-00
MRNHINIVPAAFTPQDGMTMNKDKAPMIELPFGLPVDDFLVGQTAYGSAGPSIGAPDDND
DDAAMYAYTSALNNNAAVGSLMVPPIESTFTIIDPIVGTKGEGSVPVVVVSEDQNNAVAA
IEATAPNNAELFMMPEQVAVDAPVDVEEGIMFSLESLLGLDEDMIPMEDAGGEATDDSLN
IKEGGMEIGWDLDLDYILMNNTNEFAFLDDMAWIE*

CDS

chr08:22475056..22475703 (- strand) : 648 bp

FASTA

>Os08t0458400-00 class=Sequence position=chr08:22475056..22475703 (- strand)
ATGCGTAACC ACATCAACAT AGTCCCGGCG GCCTTCACGC CTCAGGACGG GATGACAATG AATAAAGACA AGGCTCCTAT
GATCGAGCTT CCATTTGGGC TACCCGTGGA TGACTTCCTC GTTGGACAAA CCGCATATGG CAGTGCCGGA CCATCCATAG
GAGCCCCTGA CGACAACGAC GATGACGCCG CCATGTACGC CTACACAAGC GCACTGAACA ACAATGCAGC TGTTGGTTCT
CTCATGGTGC CACCAATTGA GTCAACATTC ACCATCATCG ATCCAATCGT TGGGACCAAG GGTGAGGGAT CTGTCCCTGT
TGTCGTTGTG TCAGAGGATC AGAATAATGC GGTGGCAGCA ATTGAAGCAA CAGCACCTAA CAACGCAGAA CTATTCATGA
TGCCTGAACA GGTTGCTGTT GATGCTCCGG TTGATGTTGA AGAAGGCATC ATGTTCTCTC TGGAATCGCT CTTGGGGTTG
GACGAGGACA TGATACCTAT GGAAGACGCT GGCGGTGAGG CAACTGACGA CTCACTGAAC ATAAAGGAAG GTGGCATGGA
GATCGGCTGG GACCTGGACC TGGACTACAT CCTTATGAAC AACACCAATG AATTTGCCTT CCTGGATGAC ATGGCCTGGA
TCGAGTAG

Locus: Os08g0458400

Loading...

Locus: Os08g0458400

Loading...