Os08t0473900-01

Locus

Os08g0473900

Description

Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AMY3D

CGSNL Gene Name

ALPHA-AMYLASE 3D

Oryzabase Gene Symbol Synonym(s)

Amy3D/E*(RAmy3D/E), alpha Amy3, AmyII-4, AMY1.3, Amy3D, Amy3D/E*, RAmy3D/E, Amy3D_E, Amy8, aAmy3, RAmy3D, OsAmy3D, alphaAmy3

Oryzabase Gene Name Synonym(s)

Alpha-amylase3D, Alpha-amylase isozyme 3D precursor, Alpha-amylase isozyme 3D, Alpha-amylase-3D, Amylase-8

Transcript Evidence

AK073487 (DDBJ, Best hit)

Protein Evidence

A3BU21 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: alpha-amylase activity (GO:0004556)

Molecular Function: calcium ion binding (GO:0005509)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 13 (IPR006046)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Glycosyl hydrolase, family 13, subfamily, catalytic domain (IPR006589)

Alpha-amylase, C-terminal beta-sheet (IPR012850)

Alpha-amylase, plant (IPR013775)

Glycosyl hydrolase, family 13, all-beta (IPR013780)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Alpha amylase (IPR015902)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

J033041J03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0473900-01)

RiceXPro (AK073487)

Others

Oryzabase (6858)

KEGG (Os08t0473900-01 (EC:3.2.1.1))

Transcript

1773 bp

>Os08t0473900-01 Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
ATTCCCCTGCCACGGTGACCGTGCCCCCGGTGTTCTATATATGCCCCCCGACGTCGAGGT
CATTCGCCACGAACACATCGATCATCCATCATCTACAAGAGATCGATCAGTAGTGGTTAG
CAGCAACTCACTATCGAACACGGTTTCAGCTTACACAGATATGAAGAACACCAGCAGCTT
GTGTTTGCTGCTCCTCGTGGTGCTCTGCAGCTTGACCTGTAACTCGGGTCAAGCACAGGT
CCTCTTCCAGGGTTTCAACTGGGAGTCGTGGAAGCAGCAGGGTGGCTGGTACAACATGTT
GAAAGGCCAAGTCGACGACATCGCCAAGGCCGGGGTCACCCACGTCTGGCTGCCGCCGCC
GTCGCACTCCGTGGCGCCGCAGGGGTACATGCCGGGGCGTCTCTACGACCTGGACGCGTC
CAAGTACGGCACGGCGGCGGAGCTCAAGTCGCTGATCGCGGCGTTCCACGGGAAGGGCGT
CCAGTGCGTCGCCGACGTCGTGATCAACCACCGGTGCGCCGAGAAGAAGGACGCCCGCGG
CGTGTACTGCGTGTTCGAGGGCGGGACGCCCGACGACCGCCTCGACTGGGGCCCCGGCAT
GATCTGCAGCGACGACACGCAGTACTCCGACGGCACGGGCCACCGCGACACCGGCGAGGG
GTTCGGCGCGGCGCCCGACATCGACCACCTCAACCCGCGCGTCCAGCGGGAGCTCACCGA
CTGGCTCAACTGGCTCAAGTCCGACGTCGGCTTCGACGGCTGGCGCCTCGACTTCGCCAA
GGGATACTCCACGGACATCGCTAAGATGTACGTCGAGAGCTGCAAGCCGGGCTTCGTCGT
CGCCGAGATATGGAACTCGCTGAGCTACAACGGCGACGGCAAGCCGGCGGCCAACCAGGA
CCAGGGCCGGCAGGAGCTGGTGAACTGGGTGAACGCCGTCGGCGGGCCGGCGATGACGTT
CGACTTCACCACCAAGGGCCTCCTGCAGGCGGGCGTCCAGGGCGAGCTGTGGCGGCTGCG
CGACGGCAACGGCAAGGCCGCCGGCATGATCGGGTGGCTGCCAGAGAAGGCCGTCACGTT
CGTCGACAACCACGACACCGGCTCGACGCAGAAGCTTTGGCCGTTCCCCTCCGACAAGGT
CATGCAGGGCTACGCCTACATCCTCACCCACCCCGGAGTCCCCTGCATCTTCTACGACCA
CATGTTCGACTGGAACCTGAAGCAGGAGATAACCGCGCTGGCGGCGATCAGGGAGAGGAA
CGGCATCAACGCCGGGAGCAAGCTCCGGATCGTCGTCGCCGACGCCGACGCATACGTCGC
CGTCGTCGACGAGAAGGTCATGGTGAAGATCGGGACGAGGTACGACGTGGGCAACGCGGT
GCCGTCGGATTTCCATCAGACGGTGCACGGCAAGGACTACAGCGTCTGGGAGAAGGGGTC
CCTCCGCGTCCCGGCGGGGCGGCACCTATAGCGGGCTCAAGCCCTAAACTGAACGGGATA
GTCATGCTCAAACCAGTTTCTACACGGCAAGAATTTACTGATTCTTATACTTTTGCAGTC
AATTAAATTATGGTTTTTATATATGTAATTTTGTATCCGATTGTAGCGTTCGAATAAGTA
GGCAGGCTCTCTAGCCTCTAGGTTAATTGCGGGGCATATGTAGCTTGCCAGTTAATTGTG
TTTGTATCACGCAGTTTGTAACCGTTGGTGCAATATATAATGTCAGGTTCAGGATGCAGT
AAAAAATCATACTGCACCGATCAGTGAGTTTTT

CDS

1431 bp

>Os08t0473900-01 Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
ATGCCCCCCGACGTCGAGGTCATTCGCCACGAACACATCGATCATCCATCATCTACAAGA
GATCGATCAGTAGTGGTTAGCAGCAACTCACTATCGAACACGGTTTCAGCTTACACAGAT
ATGAAGAACACCAGCAGCTTGTGTTTGCTGCTCCTCGTGGTGCTCTGCAGCTTGACCTGT
AACTCGGGTCAAGCACAGGTCCTCTTCCAGGGTTTCAACTGGGAGTCGTGGAAGCAGCAG
GGTGGCTGGTACAACATGTTGAAAGGCCAAGTCGACGACATCGCCAAGGCCGGGGTCACC
CACGTCTGGCTGCCGCCGCCGTCGCACTCCGTGGCGCCGCAGGGGTACATGCCGGGGCGT
CTCTACGACCTGGACGCGTCCAAGTACGGCACGGCGGCGGAGCTCAAGTCGCTGATCGCG
GCGTTCCACGGGAAGGGCGTCCAGTGCGTCGCCGACGTCGTGATCAACCACCGGTGCGCC
GAGAAGAAGGACGCCCGCGGCGTGTACTGCGTGTTCGAGGGCGGGACGCCCGACGACCGC
CTCGACTGGGGCCCCGGCATGATCTGCAGCGACGACACGCAGTACTCCGACGGCACGGGC
CACCGCGACACCGGCGAGGGGTTCGGCGCGGCGCCCGACATCGACCACCTCAACCCGCGC
GTCCAGCGGGAGCTCACCGACTGGCTCAACTGGCTCAAGTCCGACGTCGGCTTCGACGGC
TGGCGCCTCGACTTCGCCAAGGGATACTCCACGGACATCGCTAAGATGTACGTCGAGAGC
TGCAAGCCGGGCTTCGTCGTCGCCGAGATATGGAACTCGCTGAGCTACAACGGCGACGGC
AAGCCGGCGGCCAACCAGGACCAGGGCCGGCAGGAGCTGGTGAACTGGGTGAACGCCGTC
GGCGGGCCGGCGATGACGTTCGACTTCACCACCAAGGGCCTCCTGCAGGCGGGCGTCCAG
GGCGAGCTGTGGCGGCTGCGCGACGGCAACGGCAAGGCCGCCGGCATGATCGGGTGGCTG
CCAGAGAAGGCCGTCACGTTCGTCGACAACCACGACACCGGCTCGACGCAGAAGCTTTGG
CCGTTCCCCTCCGACAAGGTCATGCAGGGCTACGCCTACATCCTCACCCACCCCGGAGTC
CCCTGCATCTTCTACGACCACATGTTCGACTGGAACCTGAAGCAGGAGATAACCGCGCTG
GCGGCGATCAGGGAGAGGAACGGCATCAACGCCGGGAGCAAGCTCCGGATCGTCGTCGCC
GACGCCGACGCATACGTCGCCGTCGTCGACGAGAAGGTCATGGTGAAGATCGGGACGAGG
TACGACGTGGGCAACGCGGTGCCGTCGGATTTCCATCAGACGGTGCACGGCAAGGACTAC
AGCGTCTGGGAGAAGGGGTCCCTCCGCGTCCCGGCGGGGCGGCACCTATAG

Protein

477 aa

>Os08t0473900-01 Alpha-amylase isozyme 3D precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase).
MPPDVEVIRHEHIDHPSSTRDRSVVVSSNSLSNTVSAYTDMKNTSSLCLLLLVVLCSLTC
NSGQAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGR
LYDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDR
LDWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDG
WRLDFAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAV
GGPAMTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLW
PFPSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVA
DADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEKGSLRVPAGRHL*

5'UTR

chr08:23341289..23341328 (+ strand) : 40 bp

CDS

chr08:23341329..23341538 (+ strand) : 210 bp

chr08:23341663..23342601 (+ strand) : 939 bp

chr08:23342690..23342971 (+ strand) : 282 bp

3'UTR

chr08:23342972..23343273 (+ strand) : 302 bp

FASTA

>Os08t0473900-01 class=Sequence position=chr08:23341289..23343273 (+ strand)
ATTCCCCTGC CACGGTGACC GTGCCCCCGG TGTTCTATAT ATGCCCCCCG ACGTCGAGGT CATTCGCCAC GAACACATCG
ATCATCCATC ATCTACAAGA GATCGATCAG TAGTGGTTAG CAGCAACTCA CTATCGAACA CGGTTTCAGC TTACACAGAT
ATGAAGAACA CCAGCAGCTT GTGTTTGCTG CTCCTCGTGG TGCTCTGCAG CTTGACCTGT AACTCGGGTC AAGCACAGGT
CCTCTTCCAG GTACGTAGTA CTCTACTACC CATCACTTTC TGTGAAGACT TTTGCTGAAG AAACACATTA GAATTTTGAG
ATATTTATGT GTGATCGATT GATCACTTAC CTACTTATAA CATGCATCAT GCAGGGTTTC AACTGGGAGT CGTGGAAGCA
GCAGGGTGGC TGGTACAACA TGTTGAAAGG CCAAGTCGAC GACATCGCCA AGGCCGGGGT CACCCACGTC TGGCTGCCGC
CGCCGTCGCA CTCCGTGGCG CCGCAGGGGT ACATGCCGGG GCGTCTCTAC GACCTGGACG CGTCCAAGTA CGGCACGGCG
GCGGAGCTCA AGTCGCTGAT CGCGGCGTTC CACGGGAAGG GCGTCCAGTG CGTCGCCGAC GTCGTGATCA ACCACCGGTG
CGCCGAGAAG AAGGACGCCC GCGGCGTGTA CTGCGTGTTC GAGGGCGGGA CGCCCGACGA CCGCCTCGAC TGGGGCCCCG
GCATGATCTG CAGCGACGAC ACGCAGTACT CCGACGGCAC GGGCCACCGC GACACCGGCG AGGGGTTCGG CGCGGCGCCC
GACATCGACC ACCTCAACCC GCGCGTCCAG CGGGAGCTCA CCGACTGGCT CAACTGGCTC AAGTCCGACG TCGGCTTCGA
CGGCTGGCGC CTCGACTTCG CCAAGGGATA CTCCACGGAC ATCGCTAAGA TGTACGTCGA GAGCTGCAAG CCGGGCTTCG
TCGTCGCCGA GATATGGAAC TCGCTGAGCT ACAACGGCGA CGGCAAGCCG GCGGCCAACC AGGACCAGGG CCGGCAGGAG
CTGGTGAACT GGGTGAACGC CGTCGGCGGG CCGGCGATGA CGTTCGACTT CACCACCAAG GGCCTCCTGC AGGCGGGCGT
CCAGGGCGAG CTGTGGCGGC TGCGCGACGG CAACGGCAAG GCCGCCGGCA TGATCGGGTG GCTGCCAGAG AAGGCCGTCA
CGTTCGTCGA CAACCACGAC ACCGGCTCGA CGCAGAAGCT TTGGCCGTTC CCCTCCGACA AGGTCATGCA GGGCTACGCC
TACATCCTCA CCCACCCCGG AGTCCCCTGC ATCGTAAGCA AACCATGCAT TATAGTATTA TATACCATGT CCTGATTAAC
CTCCACCGTA CACGTGTCCT GATGAACGCT TCTTGTGGCA GTTCTACGAC CACATGTTCG ACTGGAACCT GAAGCAGGAG
ATAACCGCGC TGGCGGCGAT CAGGGAGAGG AACGGCATCA ACGCCGGGAG CAAGCTCCGG ATCGTCGTCG CCGACGCCGA
CGCATACGTC GCCGTCGTCG ACGAGAAGGT CATGGTGAAG ATCGGGACGA GGTACGACGT GGGCAACGCG GTGCCGTCGG
ATTTCCATCA GACGGTGCAC GGCAAGGACT ACAGCGTCTG GGAGAAGGGG TCCCTCCGCG TCCCGGCGGG GCGGCACCTA
TAGCGGGCTC AAGCCCTAAA CTGAACGGGA TAGTCATGCT CAAACCAGTT TCTACACGGC AAGAATTTAC TGATTCTTAT
ACTTTTGCAG TCAATTAAAT TATGGTTTTT ATATATGTAA TTTTGTATCC GATTGTAGCG TTCGAATAAG TAGGCAGGCT
CTCTAGCCTC TAGGTTAATT GCGGGGCATA TGTAGCTTGC CAGTTAATTG TGTTTGTATC ACGCAGTTTG TAACCGTTGG
TGCAATATAT AATGTCAGGT TCAGGATGCA GTAAAAAATC ATACTGCACC GATCAGTGAG TTTTT

Locus: Os08g0473900

Loading...

Locus: Os08g0473900

Loading...