Os08t0473900-03

Locus

Os08g0473900

Description

Similar to Alpha amylase isozyme 3D.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AMY3D

CGSNL Gene Name

ALPHA-AMYLASE 3D

Oryzabase Gene Symbol Synonym(s)

Amy3D/E*(RAmy3D/E), alpha Amy3, AmyII-4, AMY1.3, Amy3D, Amy3D/E*, RAmy3D/E, Amy3D_E, Amy8, aAmy3, RAmy3D, OsAmy3D, alphaAmy3

Oryzabase Gene Name Synonym(s)

Alpha-amylase3D, Alpha-amylase isozyme 3D precursor, Alpha-amylase isozyme 3D, Alpha-amylase-3D, Amylase-8

Transcript Evidence

AK119561 (DDBJ, Best hit)

Protein Evidence

A3BU21 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: cation binding (GO:0043169)

Functional domain (InterPro)

Glycoside hydrolase, family 13 (IPR006046)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Glycoside hydrolase, subgroup, catalytic domain (IPR013781)

Alpha amylase (IPR015902)

Glycoside hydrolase, superfamily (IPR017853)

Full-length cDNA

002-113-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0473900-03)

RiceXPro (AK119561)

Others

Oryzabase (6858)

KEGG (Os08t0473900-03)

Transcript

1760 bp

>Os08t0473900-03 Similar to Alpha amylase isozyme 3D.
ACGAACACATCGATCATCCATCATCTACAAGAGATCGATCAGTAGTGGTTAGCAGCAACT
CACTATCGAACACGGTTTCAGCTTACACAGATATGAAGAACACCAGCAGCTTGTGTTTGC
TGCTCCTCGTGGTGCTCTGCAGCTTGACCTGTAACTCGGGTCAAGCACAGGTCCTCTTCC
AGGGTTTCAACTGGGAGTCGTGGAAGCAGCAGGGTGGCTGGTACAACATGTTGAAAGGCC
AAGTCGACGACATCGCCAAGGCCGGGGTCACCCACGTCTGGCTGCCGCCGCCGTCGCACT
CCGTGGCGCCGCAGGGGTACATGCCGGGGCGTCTCTACGACCTGGACGCGTCCAAGTACG
GCACGGCGGCGGAGCTCAAGTCGCTGATCGCGGCGTTCCACGGGAAGGGCGTCCAGTGCG
TCGCCGACGTCGTGATCAACCACCGGTGCGCCGAGAAGAAGGACGCCCGCGGCGTGTACT
GCGTGTTCGAGGGCGGGACGCCCGACGACCGCCTCGACTGGGGCCCCGGCATGATCTGCA
GCGACGACACGCAGTACTCCGACGGCACGGGCCACCGCGACACCGGCGAGGGGTTCGGCG
CGGCGCCCGACATCGACCACCTCAACCCGCGCGTCCAGCGGGAGCTCACCGACTGGCTCA
ACTGGCTCAAGTCCGACGTCGGCTTCGACGGCTGGCGCCTCGACTTCGCCAAGGGATACT
CCACGGACATCGCTAAGATGTACGTCGAGAGCTGCAAGCCGGGCTTCGTCGTCGCCGAGA
TATGGAACTCGCTGAGCTACAACGGCGACGGCAAGCCGGCGGCCAACCAGGACCAGGGCC
GGCAGGAGCTGGTGAACTGGGTGAACGCCGTCGGCGGGCCGGCGATGACGTTCGACTTCA
CCACCAAGGGCCTCCTGCAGGCGGGCGTCCAGGGCGAGCTGTGGCGGCTGCGCGACGGCA
ACGGCAAGGCCGCCGGCATGATCGGGTGGCTGCCAGAGAAGGCCGTCACGTTCGTCGACA
ACCACGACACCGGCTCGACGCAGAAGCTTTGGCCGTTCCCCTCCGACAAGGTCATGCAGG
GCTACGCCTACATCCTCACCCACCCCGGAGTCCCCTGCATCGTAAGCAAACCATGCATTA
TAGTATTATATACCATGTCCTGATTAACCTCCACCGTACACGTGTCCTGATGAACGCTTC
TTGTGGCAGTTCTACGACCACATGTTCGACTGGAACCTGAAGCAGGAGATAACCGCGCTG
GCGGCGATCAGGGAGAGGAACGGCATCAACGCCGGGAGCAAGCTCCGGATCGTCGTCGCC
GACGCCGACGCATACGTCGCCGTCGTCGACGAGAAGGTCATGGTGAAGATCGGGACGAGG
TACGACGTGGGCAACGCGGTGCCGTCGGATTTCCATCAGACGGTGCACGGCAAGGACTAC
AGCGTCTGGGAGAAGGGGTCCCTCCGCGTCCCGGCGGGGCGGCACCTATAGCGGGCTCAA
GCCCTAAACTGAACGGGATAGTCATGCTCAAACCAGTTTCTACACGGCAAGAATTTACTG
ATTCTTATACTTTTGCAGTCAATTAAATTATGGTTTTTATATATGTAATTTTGTATCCGA
TTGTAGCGTTCGAATAAGTAGGCAGGCTCTCTAGCCTCTAGGTTAATTGCGGGGCATATG
TAGCTTGCCAGTTAATTGTGTTTGTATCACGCAGTTTGTAACCGTTGGTGCAATATATAA
TGTCAGGTTCAGGATGCAGT

CDS

1071 bp

>Os08t0473900-03 Similar to Alpha amylase isozyme 3D.
ATGAAGAACACCAGCAGCTTGTGTTTGCTGCTCCTCGTGGTGCTCTGCAGCTTGACCTGT
AACTCGGGTCAAGCACAGGTCCTCTTCCAGGGTTTCAACTGGGAGTCGTGGAAGCAGCAG
GGTGGCTGGTACAACATGTTGAAAGGCCAAGTCGACGACATCGCCAAGGCCGGGGTCACC
CACGTCTGGCTGCCGCCGCCGTCGCACTCCGTGGCGCCGCAGGGGTACATGCCGGGGCGT
CTCTACGACCTGGACGCGTCCAAGTACGGCACGGCGGCGGAGCTCAAGTCGCTGATCGCG
GCGTTCCACGGGAAGGGCGTCCAGTGCGTCGCCGACGTCGTGATCAACCACCGGTGCGCC
GAGAAGAAGGACGCCCGCGGCGTGTACTGCGTGTTCGAGGGCGGGACGCCCGACGACCGC
CTCGACTGGGGCCCCGGCATGATCTGCAGCGACGACACGCAGTACTCCGACGGCACGGGC
CACCGCGACACCGGCGAGGGGTTCGGCGCGGCGCCCGACATCGACCACCTCAACCCGCGC
GTCCAGCGGGAGCTCACCGACTGGCTCAACTGGCTCAAGTCCGACGTCGGCTTCGACGGC
TGGCGCCTCGACTTCGCCAAGGGATACTCCACGGACATCGCTAAGATGTACGTCGAGAGC
TGCAAGCCGGGCTTCGTCGTCGCCGAGATATGGAACTCGCTGAGCTACAACGGCGACGGC
AAGCCGGCGGCCAACCAGGACCAGGGCCGGCAGGAGCTGGTGAACTGGGTGAACGCCGTC
GGCGGGCCGGCGATGACGTTCGACTTCACCACCAAGGGCCTCCTGCAGGCGGGCGTCCAG
GGCGAGCTGTGGCGGCTGCGCGACGGCAACGGCAAGGCCGCCGGCATGATCGGGTGGCTG
CCAGAGAAGGCCGTCACGTTCGTCGACAACCACGACACCGGCTCGACGCAGAAGCTTTGG
CCGTTCCCCTCCGACAAGGTCATGCAGGGCTACGCCTACATCCTCACCCACCCCGGAGTC
CCCTGCATCGTAAGCAAACCATGCATTATAGTATTATATACCATGTCCTGA

Protein

357 aa

>Os08t0473900-03 Similar to Alpha amylase isozyme 3D.
MKNTSSLCLLLLVVLCSLTCNSGQAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVT
HVWLPPPSHSVAPQGYMPGRLYDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCA
EKKDARGVYCVFEGGTPDDRLDWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPR
VQRELTDWLNWLKSDVGFDGWRLDFAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDG
KPAANQDQGRQELVNWVNAVGGPAMTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWL
PEKAVTFVDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGVPCIVSKPCIIVLYTMS*

5'UTR

chr08:23341357..23341448 (+ strand) : 92 bp

CDS

chr08:23341449..23341538 (+ strand) : 90 bp

chr08:23341663..23342643 (+ strand) : 981 bp

3'UTR

chr08:23342644..23343240 (+ strand) : 597 bp

FASTA

>Os08t0473900-03 class=Sequence position=chr08:23341357..23343240 (+ strand)
ACGAACACAT CGATCATCCA TCATCTACAA GAGATCGATC AGTAGTGGTT AGCAGCAACT CACTATCGAA CACGGTTTCA
GCTTACACAG ATATGAAGAA CACCAGCAGC TTGTGTTTGC TGCTCCTCGT GGTGCTCTGC AGCTTGACCT GTAACTCGGG
TCAAGCACAG GTCCTCTTCC AGGTACGTAG TACTCTACTA CCCATCACTT TCTGTGAAGA CTTTTGCTGA AGAAACACAT
TAGAATTTTG AGATATTTAT GTGTGATCGA TTGATCACTT ACCTACTTAT AACATGCATC ATGCAGGGTT TCAACTGGGA
GTCGTGGAAG CAGCAGGGTG GCTGGTACAA CATGTTGAAA GGCCAAGTCG ACGACATCGC CAAGGCCGGG GTCACCCACG
TCTGGCTGCC GCCGCCGTCG CACTCCGTGG CGCCGCAGGG GTACATGCCG GGGCGTCTCT ACGACCTGGA CGCGTCCAAG
TACGGCACGG CGGCGGAGCT CAAGTCGCTG ATCGCGGCGT TCCACGGGAA GGGCGTCCAG TGCGTCGCCG ACGTCGTGAT
CAACCACCGG TGCGCCGAGA AGAAGGACGC CCGCGGCGTG TACTGCGTGT TCGAGGGCGG GACGCCCGAC GACCGCCTCG
ACTGGGGCCC CGGCATGATC TGCAGCGACG ACACGCAGTA CTCCGACGGC ACGGGCCACC GCGACACCGG CGAGGGGTTC
GGCGCGGCGC CCGACATCGA CCACCTCAAC CCGCGCGTCC AGCGGGAGCT CACCGACTGG CTCAACTGGC TCAAGTCCGA
CGTCGGCTTC GACGGCTGGC GCCTCGACTT CGCCAAGGGA TACTCCACGG ACATCGCTAA GATGTACGTC GAGAGCTGCA
AGCCGGGCTT CGTCGTCGCC GAGATATGGA ACTCGCTGAG CTACAACGGC GACGGCAAGC CGGCGGCCAA CCAGGACCAG
GGCCGGCAGG AGCTGGTGAA CTGGGTGAAC GCCGTCGGCG GGCCGGCGAT GACGTTCGAC TTCACCACCA AGGGCCTCCT
GCAGGCGGGC GTCCAGGGCG AGCTGTGGCG GCTGCGCGAC GGCAACGGCA AGGCCGCCGG CATGATCGGG TGGCTGCCAG
AGAAGGCCGT CACGTTCGTC GACAACCACG ACACCGGCTC GACGCAGAAG CTTTGGCCGT TCCCCTCCGA CAAGGTCATG
CAGGGCTACG CCTACATCCT CACCCACCCC GGAGTCCCCT GCATCGTAAG CAAACCATGC ATTATAGTAT TATATACCAT
GTCCTGATTA ACCTCCACCG TACACGTGTC CTGATGAACG CTTCTTGTGG CAGTTCTACG ACCACATGTT CGACTGGAAC
CTGAAGCAGG AGATAACCGC GCTGGCGGCG ATCAGGGAGA GGAACGGCAT CAACGCCGGG AGCAAGCTCC GGATCGTCGT
CGCCGACGCC GACGCATACG TCGCCGTCGT CGACGAGAAG GTCATGGTGA AGATCGGGAC GAGGTACGAC GTGGGCAACG
CGGTGCCGTC GGATTTCCAT CAGACGGTGC ACGGCAAGGA CTACAGCGTC TGGGAGAAGG GGTCCCTCCG CGTCCCGGCG
GGGCGGCACC TATAGCGGGC TCAAGCCCTA AACTGAACGG GATAGTCATG CTCAAACCAG TTTCTACACG GCAAGAATTT
ACTGATTCTT ATACTTTTGC AGTCAATTAA ATTATGGTTT TTATATATGT AATTTTGTAT CCGATTGTAG CGTTCGAATA
AGTAGGCAGG CTCTCTAGCC TCTAGGTTAA TTGCGGGGCA TATGTAGCTT GCCAGTTAAT TGTGTTTGTA TCACGCAGTT
TGTAACCGTT GGTGCAATAT ATAATGTCAG GTTCAGGATG CAGT

Locus: Os08g0473900

Loading...

Locus: Os08g0473900

Loading...