Os08t0492000-01

Locus

Os08g0492000

Description

Similar to Glutathione transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT9

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 9

Transcript Evidence

AK100814 (DDBJ, Best hit)

Protein Evidence

XP_002323113.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023122C04 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0492000-01)

RiceXPro (AK100814)

Others

Oryzabase (12499)

KEGG (Os08t0492000-01)

Transcript

2504 bp

>Os08t0492000-01 Similar to Glutathione transporter.
GGCGAGGACCAGTACCAATGGAGCAACCACGGCTTGAGCTCAGCAGCCTGGAAGGTCACC
GGAGTAGCGAAAATCCAGAGAGCAGAGATGAGAAAACCGAAGAGGAGGTAGACGACTGCC
CGATCGAGGAGGTGCGGCTGACGGTGCCGATCACCGACGACCCGGCATTGCCGGCGCTGA
CGTTCAGGACATGGCTGCTGGGGCTCATCTCCTGCGCGATGCTGGCCTTCTCCAACCAGT
TCTTCGGCTACCGGCAGAATCCGCTCTACATCTCGTCGCTGTCCGTGCAGATCGTCGTCT
TGCCGCTGGGCAAGCTGATGGCTGCTTGCCTCCCCAAGAAGGTGTTCAGGGTGAAGGGCA
CGGCATGGTCGTTCTCGCTCAACCCGGGGCCGTTCAACCTCAAGGAGCATGTGCTCATCA
CCATCTTCGCCAACACCGGATCCAACTCCGTCTACGCCGTCGGCATTATCACCATTGTTA
AGGCCTTCTACCGCCGGGAGATTCATCCTCTTGCTGCCATGCTGCTCACCCAGACAACCC
AGCTGATGGGATATGGTTGGGCTGGCCTCTTCAGAAAGTTTCTTGTGGACTCACCTTACA
TGTGGTGGCCTTCAAACTTGGTACAGGTTTCACTCTTCAGAGCTCTGCATGAGAAGGAGA
AGAGGCCAAAGGGAGGGACGACGAGGCTGCAGTTCTTCCTGACCGTGCTCATCACCAGCT
TCGCCTACTACATTGTGCCGAACTACCTGTTCCCGACCATCTCCACCATCTCGGTGGTGT
GCCTGGTGTGGAAGAAGTCGGTGACGGCGCAGCAGATCGGCTCCGGCGTGTACGGCCTGG
GCGTCGGCTCGTTCGGCCTGGACTGGGCGACGGTGGCCGGCTTCCTCGGCACGCCGCTGT
CGACGCCGGCGTTCGCCATCGTCAACATCATGGCCGGCTTCTTCCTCATCGTCTACGTGA
TCGTGCCGGCGGCGTACTGGGCCGACGCGTACGGCGCCAAGCGGTTCCCGATCATCTCCT
CCCACGTGTTCTCCGCCAACGGCAGCCGGTACGACGTCAACCAGGTGCTCGACACGGCGA
CGTTCGAGTTCAGCCAGGCCGGGTACGACGCCGCGGGCAAGATCAACCTGAGCATCTTCT
TCGCCTTCACCTACGGCCTCAGCTTCGCCACGCTCGCCGCGACGCTGTCGCACGTCGCGC
TCTTCCACGGCGGGTCGATATGGCGGCAGACCAAGGCGGCGGTGAGCGGGCAGGGCGGCG
ACGTGCACACCAGGCTGATGAAGCGCAACTACGCCGCGGTGCCGCAGTGGTGGTTCCAGG
TGATGCTCGTCGCCGTGCTCGGCCTCTCCGTGTTCACCTGCGAGGGCTTCGGCCAGCAGC
TGCAGCTCCCGTACTGGGGCGTCCTCCTCGCCGCCGGCCTCGCCTTCTTCTTCACCCTCC
CCATCGGCATCATCACCGCCACCACCAATCAGCAACCTGGGCTGAACGTGATCACCGAGC
TGATCATCGGATACCTGTACCCGGGGAGGCCGCTCGCCAACGTCGCCTTCAAGACGTACG
GCTACATCAGCATGTCCCAGGCGATCATGTTCTTGCAGGATTTCAAGCTGGGCCACTACA
TGAAGATCCCACCACGCTCCATGTTCATCGTCCAGCTCGTCGGGACGGTGCTGGCGTCGT
CGGTGTACTTCGGGACGTCGTGGTGGCTGCTGGAGAGCGTGAGCAACATCTGCGACCCGG
CGAAGCTGCCGGAGGGGAGCCCGTGGACGTGCCCCGGCGACGACGTCTTCTTCAACGCCT
CCATCATCTGGGGGGTGGTCGGCCCGCTGCGGATGTTCGGCCGCCTCGGCCTGTACGCCA
AGATGAACTACTTCTTCCTCGCCGGCGCGCTGGCGCCGGTGCCGGTGTGGGCGCTGTCGC
GGGCGTTCCCGGGCAGGGCGTGGATCGGGCTCGTCAACATGCCGGTGCTCCTCGGCGCCA
CGGGGATGATGCCGCCGGCGAGGTCGGTGAACTACCTCATGTGGGGCGCCGTGGGGCTCG
CCTTCAACTACGTCGTGTACCGCCGGTACAAGGGGTGGTGGGCGCGGCACAACTACGTGC
TGTCCGCCGGGCTGGACGCCGGCGTGGCCTTCATGGGGATCCTCTCGTACGCCGTGCTGC
AGTCGAGGGGCATCAATGGCGTCAACTGGTGGGGGCTGCAGGTGGACGACCACTGCGCCC
TGGCTCGTTGCCCCACGGCGCCCGGGGTCAGCGCCCCCGGCTGCCCGGTGCAGTGAGCAG
AGCAGACCATTGGCATCAATCAGCTGGGAAAACTTAGGGCAGTTAGGATTATAGGTCTAT
ATAGCTCCTCAAGTTTATAAATGATCGTTGACCAAAAATGGCATTGGAAAAGATCAGCAC
ACAGCACTACTGTGTAATTGTGCGTAAAACAAAAGCGCCGTATGTAACTATGTATGTAGT
GATGAATAGTCTGATTATATGTCAAACGCATGTGCTTGTTCTGC

CDS

2259 bp

>Os08t0492000-01 Similar to Glutathione transporter.
ATGGAGCAACCACGGCTTGAGCTCAGCAGCCTGGAAGGTCACCGGAGTAGCGAAAATCCA
GAGAGCAGAGATGAGAAAACCGAAGAGGAGGTAGACGACTGCCCGATCGAGGAGGTGCGG
CTGACGGTGCCGATCACCGACGACCCGGCATTGCCGGCGCTGACGTTCAGGACATGGCTG
CTGGGGCTCATCTCCTGCGCGATGCTGGCCTTCTCCAACCAGTTCTTCGGCTACCGGCAG
AATCCGCTCTACATCTCGTCGCTGTCCGTGCAGATCGTCGTCTTGCCGCTGGGCAAGCTG
ATGGCTGCTTGCCTCCCCAAGAAGGTGTTCAGGGTGAAGGGCACGGCATGGTCGTTCTCG
CTCAACCCGGGGCCGTTCAACCTCAAGGAGCATGTGCTCATCACCATCTTCGCCAACACC
GGATCCAACTCCGTCTACGCCGTCGGCATTATCACCATTGTTAAGGCCTTCTACCGCCGG
GAGATTCATCCTCTTGCTGCCATGCTGCTCACCCAGACAACCCAGCTGATGGGATATGGT
TGGGCTGGCCTCTTCAGAAAGTTTCTTGTGGACTCACCTTACATGTGGTGGCCTTCAAAC
TTGGTACAGGTTTCACTCTTCAGAGCTCTGCATGAGAAGGAGAAGAGGCCAAAGGGAGGG
ACGACGAGGCTGCAGTTCTTCCTGACCGTGCTCATCACCAGCTTCGCCTACTACATTGTG
CCGAACTACCTGTTCCCGACCATCTCCACCATCTCGGTGGTGTGCCTGGTGTGGAAGAAG
TCGGTGACGGCGCAGCAGATCGGCTCCGGCGTGTACGGCCTGGGCGTCGGCTCGTTCGGC
CTGGACTGGGCGACGGTGGCCGGCTTCCTCGGCACGCCGCTGTCGACGCCGGCGTTCGCC
ATCGTCAACATCATGGCCGGCTTCTTCCTCATCGTCTACGTGATCGTGCCGGCGGCGTAC
TGGGCCGACGCGTACGGCGCCAAGCGGTTCCCGATCATCTCCTCCCACGTGTTCTCCGCC
AACGGCAGCCGGTACGACGTCAACCAGGTGCTCGACACGGCGACGTTCGAGTTCAGCCAG
GCCGGGTACGACGCCGCGGGCAAGATCAACCTGAGCATCTTCTTCGCCTTCACCTACGGC
CTCAGCTTCGCCACGCTCGCCGCGACGCTGTCGCACGTCGCGCTCTTCCACGGCGGGTCG
ATATGGCGGCAGACCAAGGCGGCGGTGAGCGGGCAGGGCGGCGACGTGCACACCAGGCTG
ATGAAGCGCAACTACGCCGCGGTGCCGCAGTGGTGGTTCCAGGTGATGCTCGTCGCCGTG
CTCGGCCTCTCCGTGTTCACCTGCGAGGGCTTCGGCCAGCAGCTGCAGCTCCCGTACTGG
GGCGTCCTCCTCGCCGCCGGCCTCGCCTTCTTCTTCACCCTCCCCATCGGCATCATCACC
GCCACCACCAATCAGCAACCTGGGCTGAACGTGATCACCGAGCTGATCATCGGATACCTG
TACCCGGGGAGGCCGCTCGCCAACGTCGCCTTCAAGACGTACGGCTACATCAGCATGTCC
CAGGCGATCATGTTCTTGCAGGATTTCAAGCTGGGCCACTACATGAAGATCCCACCACGC
TCCATGTTCATCGTCCAGCTCGTCGGGACGGTGCTGGCGTCGTCGGTGTACTTCGGGACG
TCGTGGTGGCTGCTGGAGAGCGTGAGCAACATCTGCGACCCGGCGAAGCTGCCGGAGGGG
AGCCCGTGGACGTGCCCCGGCGACGACGTCTTCTTCAACGCCTCCATCATCTGGGGGGTG
GTCGGCCCGCTGCGGATGTTCGGCCGCCTCGGCCTGTACGCCAAGATGAACTACTTCTTC
CTCGCCGGCGCGCTGGCGCCGGTGCCGGTGTGGGCGCTGTCGCGGGCGTTCCCGGGCAGG
GCGTGGATCGGGCTCGTCAACATGCCGGTGCTCCTCGGCGCCACGGGGATGATGCCGCCG
GCGAGGTCGGTGAACTACCTCATGTGGGGCGCCGTGGGGCTCGCCTTCAACTACGTCGTG
TACCGCCGGTACAAGGGGTGGTGGGCGCGGCACAACTACGTGCTGTCCGCCGGGCTGGAC
GCCGGCGTGGCCTTCATGGGGATCCTCTCGTACGCCGTGCTGCAGTCGAGGGGCATCAAT
GGCGTCAACTGGTGGGGGCTGCAGGTGGACGACCACTGCGCCCTGGCTCGTTGCCCCACG
GCGCCCGGGGTCAGCGCCCCCGGCTGCCCGGTGCAGTGA

Protein

753 aa

>Os08t0492000-01 Similar to Glutathione transporter.
MEQPRLELSSLEGHRSSENPESRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWL
LGLISCAMLAFSNQFFGYRQNPLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFS
LNPGPFNLKEHVLITIFANTGSNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYG
WAGLFRKFLVDSPYMWWPSNLVQVSLFRALHEKEKRPKGGTTRLQFFLTVLITSFAYYIV
PNYLFPTISTISVVCLVWKKSVTAQQIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFA
IVNIMAGFFLIVYVIVPAAYWADAYGAKRFPIISSHVFSANGSRYDVNQVLDTATFEFSQ
AGYDAAGKINLSIFFAFTYGLSFATLAATLSHVALFHGGSIWRQTKAAVSGQGGDVHTRL
MKRNYAAVPQWWFQVMLVAVLGLSVFTCEGFGQQLQLPYWGVLLAAGLAFFFTLPIGIIT
ATTNQQPGLNVITELIIGYLYPGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPR
SMFIVQLVGTVLASSVYFGTSWWLLESVSNICDPAKLPEGSPWTCPGDDVFFNASIIWGV
VGPLRMFGRLGLYAKMNYFFLAGALAPVPVWALSRAFPGRAWIGLVNMPVLLGATGMMPP
ARSVNYLMWGAVGLAFNYVVYRRYKGWWARHNYVLSAGLDAGVAFMGILSYAVLQSRGIN
GVNWWGLQVDDHCALARCPTAPGVSAPGCPVQ*

5'UTR

chr08:24311145..24311161 (+ strand) : 17 bp

CDS

chr08:24311162..24311243 (+ strand) : 82 bp

chr08:24311376..24311818 (+ strand) : 443 bp

chr08:24311987..24312084 (+ strand) : 98 bp

chr08:24312224..24313055 (+ strand) : 832 bp

chr08:24313705..24313887 (+ strand) : 183 bp

chr08:24313968..24314588 (+ strand) : 621 bp

3'UTR

chr08:24314589..24314816 (+ strand) : 228 bp

FASTA

>Os08t0492000-01 class=Sequence position=chr08:24311145..24314816 (+ strand)
GGCGAGGACC AGTACCAATG GAGCAACCAC GGCTTGAGCT CAGCAGCCTG GAAGGTCACC GGAGTAGCGA AAATCCAGAG
AGCAGAGATG AGAAAACCGG TGAGTTCGTT CAGTTCTCCA CCCAAGATTC TTCTTCTTTC TTGCTGTTCA GAAAACATGG
CATTGTTTGA TGTTCAGAAA TTCCTTTTTA TGCTCAAAGA TATGAGAGTG TTCGATGTTC TTGTGGTGCA GAAGAGGAGG
TAGACGACTG CCCGATCGAG GAGGTGCGGC TGACGGTGCC GATCACCGAC GACCCGGCAT TGCCGGCGCT GACGTTCAGG
ACATGGCTGC TGGGGCTCAT CTCCTGCGCG ATGCTGGCCT TCTCCAACCA GTTCTTCGGC TACCGGCAGA ATCCGCTCTA
CATCTCGTCG CTGTCCGTGC AGATCGTCGT CTTGCCGCTG GGCAAGCTGA TGGCTGCTTG CCTCCCCAAG AAGGTGTTCA
GGGTGAAGGG CACGGCATGG TCGTTCTCGC TCAACCCGGG GCCGTTCAAC CTCAAGGAGC ATGTGCTCAT CACCATCTTC
GCCAACACCG GATCCAACTC CGTCTACGCC GTCGGCATTA TCACCATTGT TAAGGCCTTC TACCGCCGGG AGATTCATCC
TCTTGCTGCC ATGCTGCTCA CCCAGACAAC CCAGGTACAT ACATGTGACT TCGACTGACA CCTGACAAAT TGTGTCCTGA
AAATTGTTTC CATGTTCTAG TTGGAAGTAC TGATTTTCAG GTTCATAATC TTTCTGTGTT GCTGGTTTGC TGTCTTAATC
TCTTTTTTCT TTTGGCTCTA ATCTTTCTGT GTTTGTGGGC AGCTGATGGG ATATGGTTGG GCTGGCCTCT TCAGAAAGTT
TCTTGTGGAC TCACCTTACA TGTGGTGGCC TTCAAACTTG GTACAGGTTT CACTCTTCAG GTCTGTAATT CTGTAATTAC
ATTCTCATTT CTCTGAAAAC TAACCTGTTC TTAAGCTGTA ATAATAATAA TTCTGTAATT GAAGTAGTAA TATGTGTGTT
GAGATTTTTG ATTGGTGGCT ATGACAAAAA AAAATGCAGA GCTCTGCATG AGAAGGAGAA GAGGCCAAAG GGAGGGACGA
CGAGGCTGCA GTTCTTCCTG ACCGTGCTCA TCACCAGCTT CGCCTACTAC ATTGTGCCGA ACTACCTGTT CCCGACCATC
TCCACCATCT CGGTGGTGTG CCTGGTGTGG AAGAAGTCGG TGACGGCGCA GCAGATCGGC TCCGGCGTGT ACGGCCTGGG
CGTCGGCTCG TTCGGCCTGG ACTGGGCGAC GGTGGCCGGC TTCCTCGGCA CGCCGCTGTC GACGCCGGCG TTCGCCATCG
TCAACATCAT GGCCGGCTTC TTCCTCATCG TCTACGTGAT CGTGCCGGCG GCGTACTGGG CCGACGCGTA CGGCGCCAAG
CGGTTCCCGA TCATCTCCTC CCACGTGTTC TCCGCCAACG GCAGCCGGTA CGACGTCAAC CAGGTGCTCG ACACGGCGAC
GTTCGAGTTC AGCCAGGCCG GGTACGACGC CGCGGGCAAG ATCAACCTGA GCATCTTCTT CGCCTTCACC TACGGCCTCA
GCTTCGCCAC GCTCGCCGCG ACGCTGTCGC ACGTCGCGCT CTTCCACGGC GGGTCGATAT GGCGGCAGAC CAAGGCGGCG
GTGAGCGGGC AGGGCGGCGA CGTGCACACC AGGCTGATGA AGCGCAACTA CGCCGCGGTG CCGCAGTGGT GGTTCCAGGT
GATGCTCGTC GCCGTGCTCG GCCTCTCCGT GTTCACCTGC GAGGGCTTCG GCCAGCAGCT GCAGCTCCCG TACTGGGGCG
TCCTCCTCGC CGCCGGCCTC GCCTTCTTCT TCACCCTCCC CATCGGCATC ATCACCGCCA CCACCAATCA GGTGACTCAT
TCATTCCAGA CTAACTCCGT AATAATTAGG ATATGTTTAG AGAGCTTAAA ATTCTAAGAA ATAAGCCGTT TATGAGTATG
AAAAAAGTTA TGTTTCTTAG CTCCTACTTT CTAGTTCATA TTCTAAATTC TACAATTACA ATTTTTCAGA ATTTGGTTGC
TTTCTACTTT ATTTTCTGAA TTTTAATTTA AACAATTTAT CAGAAttcgg ttgccttcag tttattttct agattatata
attacaattt atcaaaattt aaagaaaaag gctacttatt CGGGAATACG CTAGATGCGT ATTTTTTGTT AAGAGGAATA
AAACATATTT TTACAGCCCA AAACTAAGAA CAGCAGGGGA CGGGAATACT AGATAGGAAG AGCTAAAGCC TATTCTCACA
ACAGAAGAAG CGACCTAAAA AACGACCTAG CTCTAGAGAC GTAGCGCCGG CACTGCGGCG TTATTTTTTC AATTCTACAA
TTACAATTTT TTAGTATGGC CAAAAAAGAA AGGGATTATT TGAAAGAGAC TTTGATTCTA GGAGAAGAAG TAGCTACCAA
AAGCTCCCTC AGAGATGTTC TTAAACTCAT GAATAGTGAA TTCGTGATCA ATTTATGGTT CTTTTTGGTT TCTTGGACAG
CAACCTGGGC TGAACGTGAT CACCGAGCTG ATCATCGGAT ACCTGTACCC GGGGAGGCCG CTCGCCAACG TCGCCTTCAA
GACGTACGGC TACATCAGCA TGTCCCAGGC GATCATGTTC TTGCAGGATT TCAAGCTGGG CCACTACATG AAGATCCCAC
CACGCTCCAT GTTCATCGTC CAGGTGAGCC CCCATCGGCT GAATCCGGAC ATCGATTCGT CGGAGGAGAA TGTGAGCGAA
TTTGCCCGGT TTTGTTCATG CAGCTCGTCG GGACGGTGCT GGCGTCGTCG GTGTACTTCG GGACGTCGTG GTGGCTGCTG
GAGAGCGTGA GCAACATCTG CGACCCGGCG AAGCTGCCGG AGGGGAGCCC GTGGACGTGC CCCGGCGACG ACGTCTTCTT
CAACGCCTCC ATCATCTGGG GGGTGGTCGG CCCGCTGCGG ATGTTCGGCC GCCTCGGCCT GTACGCCAAG ATGAACTACT
TCTTCCTCGC CGGCGCGCTG GCGCCGGTGC CGGTGTGGGC GCTGTCGCGG GCGTTCCCGG GCAGGGCGTG GATCGGGCTC
GTCAACATGC CGGTGCTCCT CGGCGCCACG GGGATGATGC CGCCGGCGAG GTCGGTGAAC TACCTCATGT GGGGCGCCGT
GGGGCTCGCC TTCAACTACG TCGTGTACCG CCGGTACAAG GGGTGGTGGG CGCGGCACAA CTACGTGCTG TCCGCCGGGC
TGGACGCCGG CGTGGCCTTC ATGGGGATCC TCTCGTACGC CGTGCTGCAG TCGAGGGGCA TCAATGGCGT CAACTGGTGG
GGGCTGCAGG TGGACGACCA CTGCGCCCTG GCTCGTTGCC CCACGGCGCC CGGGGTCAGC GCCCCCGGCT GCCCGGTGCA
GTGAGCAGAG CAGACCATTG GCATCAATCA GCTGGGAAAA CTTAGGGCAG TTAGGATTAT AGGTCTATAT AGCTCCTCAA
GTTTATAAAT GATCGTTGAC CAAAAATGGC ATTGGAAAAG ATCAGCACAC AGCACTACTG TGTAATTGTG CGTAAAACAA
AAGCGCCGTA TGTAACTATG TATGTAGTGA TGAATAGTCT GATTATATGT CAAACGCATG TGCTTGTTCT GC

Locus: Os08g0492000

Loading...

Locus: Os08g0492000

Loading...