Os08t0496500-01

Locus

Os08g0496500

Description

NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date

RAP-DB Gene Symbol Synonym(s)

OsHAP5D, OsNF-YC6

RAP-DB Gene Name Synonym(s)

Nuclear factor Y C6 subunit

CGSNL Gene Symbol

HAP5D

CGSNL Gene Name

HAP5D SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5D, NF-YC, CBF-C, OsNF-YC6, Os-NF-YC6, NF-YC6, NFYC6

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C6 subunit, Nuclear factor Y C subunit 6, NUCLEAR FACTOR-Y subunit C6, NUCLEAR FACTOR-Y subunit NF-YC6, NF-YC subunit 6, NF-YC family 6

Transcript Evidence

AK108510

Protein Evidence

Q9XE33

Literature

PMID: 30107076

PMID: 26542958

Note

Manual Curation

January 25, 2019

Gene Ontology (GO)

Molecular Function: protein heterodimerization activity (GO:0046982)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone domain (IPR003958)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-144-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0496500-01)

RiceXPro (AK108510)

Others

Oryzabase (8494)

KEGG (Os08t0496500-01)

Transcript

962 bp

>Os08t0496500-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
GCTCCGCATCGGCAGCAACCGTTGCGACCAATTCCCCCAATTCCATTCCATTCCCCTCCT
CCCCCGGAGAGAAACCCTAGCAATGGAGCCCAAATCCACCACCCCTCCTCCGCCTCCTCC
GCCCCCCGTGCTGGGCGCCCCCGTCCCTTACCCGCCGGCGGGAGCCTACCCCCCACCCGT
CGGGCCCTACGCCCACGCGCCGCCGCTCTACGCCCCGCCTCCCCCCGCCGCCGCCGCCGC
CTCCGCCGCCGCCACCGCCGCCTCGCAGCAGGCCGCCGCCGCGCAGCTCCAGAACTTCTG
GGCGGAGCAGTACCGCGAGATCGAGCACACCACCGACTTCAAGAACCACAACCTCCCCCT
CGCCCGCATCAAGAAGATCATGAAGGCCGACGAGGACGTCCGCATGATCGCCGCCGAGGC
CCCCGTCGTGTTCGCCAGGGCGTGCGAGATGTTCATCCTCGAGCTCACCCACCGCGGCTG
GGCGCACGCCGAGGAGAACAAGCGCCGCACGCTCCAGAAGTCCGACAtcgccgccgccat
cgcccgcaccgaggtcttcgacttcctcgtcgacatcgtgccccgcgacgaggccaagga
cgccgaggccgccgccgccgttgccgccgggatcccccaccccgccgccggtttgccCGC
CACCGACCCCATGGCCTACTACTATGTCCAGCCGCAGTAACATTTTCCTACCGTATAGCT
TCAAGTTTATTTAGCGATTTTTATTTATGGAATGCTTTTCTGCTGTTGTCGTAGTTGTTA
TTATGTTTTGCTTGTTGTTGCCGTGTAATAACTAGAAGATGTGATTATCATTGTGAGGAG
CCTCCTCTCGGTGTATAAACAATCCGATTTGAGGATTGGGCGAGCTTTGTTGCGATTGAG
GAAGGCTGTATGGTGGTTTTGATGCATGTCTAACTTATATCACAATGAATTATTTATTAC
CC

CDS

618 bp

>Os08t0496500-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
ATGGAGCCCAAATCCACCACCCCTCCTCCGCCTCCTCCGCCCCCCGTGCTGGGCGCCCCC
GTCCCTTACCCGCCGGCGGGAGCCTACCCCCCACCCGTCGGGCCCTACGCCCACGCGCCG
CCGCTCTACGCCCCGCCTCCCCCCGCCGCCGCCGCCGCCTCCGCCGCCGCCACCGCCGCC
TCGCAGCAGGCCGCCGCCGCGCAGCTCCAGAACTTCTGGGCGGAGCAGTACCGCGAGATC
GAGCACACCACCGACTTCAAGAACCACAACCTCCCCCTCGCCCGCATCAAGAAGATCATG
AAGGCCGACGAGGACGTCCGCATGATCGCCGCCGAGGCCCCCGTCGTGTTCGCCAGGGCG
TGCGAGATGTTCATCCTCGAGCTCACCCACCGCGGCTGGGCGCACGCCGAGGAGAACAAG
CGCCGCACGCTCCAGAAGTCCGACAtcgccgccgccatcgcccgcaccgaggtcttcgac
ttcctcgtcgacatcgtgccccgcgacgaggccaaggacgccgaggccgccgccgccgtt
gccgccgggatcccccaccccgccgccggtttgccCGCCACCGACCCCATGGCCTACTAC
TATGTCCAGCCGCAGTAA

Protein

206 aa

>Os08t0496500-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
MEPKSTTPPPPPPPPVLGAPVPYPPAGAYPPPVGPYAHAPPLYAPPPPAAAAASAAATAA
SQQAAAAQLQNFWAEQYREIEHTTDFKNHNLPLARIKKIMKADEDVRMIAAEAPVVFARA
CEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEVFDFLVDIVPRDEAKDAEAAAAV
AAGIPHPAAGLPATDPMAYYYVQPQ*

5'UTR

chr08:24517598..24517679 (+ strand) : 82 bp

CDS

chr08:24517680..24518297 (+ strand) : 618 bp

3'UTR

chr08:24518298..24518559 (+ strand) : 262 bp

FASTA

>Os08t0496500-01 class=Sequence position=chr08:24517598..24518559 (+ strand)
GCTCCGCATC GGCAGCAACC GTTGCGACCA ATTCCCCCAA TTCCATTCCA TTCCCCTCCT CCCCCGGAGA GAAACCCTAG
CAATGGAGCC CAAATCCACC ACCCCTCCTC CGCCTCCTCC GCCCCCCGTG CTGGGCGCCC CCGTCCCTTA CCCGCCGGCG
GGAGCCTACC CCCCACCCGT CGGGCCCTAC GCCCACGCGC CGCCGCTCTA CGCCCCGCCT CCCCCCGCCG CCGCCGCCGC
CTCCGCCGCC GCCACCGCCG CCTCGCAGCA GGCCGCCGCC GCGCAGCTCC AGAACTTCTG GGCGGAGCAG TACCGCGAGA
TCGAGCACAC CACCGACTTC AAGAACCACA ACCTCCCCCT CGCCCGCATC AAGAAGATCA TGAAGGCCGA CGAGGACGTC
CGCATGATCG CCGCCGAGGC CCCCGTCGTG TTCGCCAGGG CGTGCGAGAT GTTCATCCTC GAGCTCACCC ACCGCGGCTG
GGCGCACGCC GAGGAGAACA AGCGCCGCAC GCTCCAGAAG TCCGACAtcg ccgccgccat cgcccgcacc gaggtcttcg
acttcctcgt cgacatcgtg ccccgcgacg aggccaagga cgccgaggcc gccgccgccg ttgccgccgg gatcccccac
cccgccgccg gtttgccCGC CACCGACCCC ATGGCCTACT ACTATGTCCA GCCGCAGTAA CATTTTCCTA CCGTATAGCT
TCAAGTTTAT TTAGCGATTT TTATTTATGG AATGCTTTTC TGCTGTTGTC GTAGTTGTTA TTATGTTTTG CTTGTTGTTG
CCGTGTAATA ACTAGAAGAT GTGATTATCA TTGTGAGGAG CCTCCTCTCG GTGTATAAAC AATCCGATTT GAGGATTGGG
CGAGCTTTGT TGCGATTGAG GAAGGCTGTA TGGTGGTTTT GATGCATGTC TAACTTATAT CACAATGAAT TATTTATTAC
CC

Locus: Os08g0496500

Loading...

Locus: Os08g0496500

Loading...