Os08t0499300-01

Locus

Os08g0499300

Description

WRKY transcription factor, Disease resistance against X. oryzae, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

OsWRKY30

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY30

CGSNL Gene Name

WRKY GENE 30

Oryzabase Gene Symbol Synonym(s)

OsWRKY30

Oryzabase Gene Name Synonym(s)

Rice WRKY gene30

Transcript Evidence

AK065518

Protein Evidence

Q6ZKN0

Literature

PMID: 27897241

PMID: 22875749

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

October 13, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain superfamily (IPR036576)

WRKY domain (IPR003657)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J013025I24 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0499300-01)

RiceXPro (AK065518)

Others

Oryzabase (6543)

KEGG (Os08t0499300-01)

Transcript

2352 bp

>Os08t0499300-01 WRKY transcription factor, Disease resistance against X. oryzae, Drought tolerance
TCCTTCGCTTCACCACCTCGCCAAAACCGCCTTCCCTTCCCTTCTCTTCCCTTCCAACCT
CTCGTTGCGGTTTGCGCTAGAAAAAAAAGAGAGGAGAGATTTCAAGAAACCGTGGGGGAG
AAAGAAGCAGGCAAGAAGTAGCAGCAGCAGCGAGTGAGGCTAATCTGTTTGAGCTTGGGA
TTGTCACCTTTTCATGGACGGGACCAACAACCATGGAGCACTGATGGACGATTGGATGCT
TCCCTCACCCAGTCCAAGAACACTCATGTCGAGTTTCTTGAACGAAGAATTCAGCTCCGG
TCCCTTTTCAGACATTTTCTGTGATAATGGCAGTAACAAACATCAGGATGGACTTGGGAA
GAGCAAAGCTTTCATCGATTCAAGCCGGGAAGAAACTGCTCAGCTAGCAAAAAAGTTTGA
ATCAAACCTTTTTGGTGCCAACCAGAAATCAAGCTCAAATGGCTGTCTGTCAGAGAGGAT
GGCTGCAAGGACAGGTTTTGGTGTCCTGAAAATTGATACATCTCGTGTCGGTTATTCTAC
ACCGATTCGGTCTCCGGTGACGATCCCGCCCGGTGTGAGTCCAAGGGAACTTCTTGAGTC
GCCGGTTTTTCTTCCGAACGCCATTGCACAACCTTCTCCTACCACTGGCAAACTGCCATT
TTTGATGCATAGTAATGTTAAACCATCGATCCCTAAAAAAACTGAAGATGAAACACGCCA
TGATCGTGTATTCTTCTTTCAACCCATTTTGGGATCTAAGCCACCAACTTGTCCAGTTGC
AGAGAAGGGTTTCAGTGTTAATCATCAAAACCAGCCTTCAGTGACGGATAATCACCAGGA
GCTCAGTCTTCAGTCTAGCTCAACTGCAGCCAAGGATTTCACTTCAGCAACTATTGTTAA
ACCTaagacatctgattccatgttagacaatgatgatcacccttcccctgcaaatgatca
agaagagaatgcaacaaacaaaaatgaagagtattcttcagaCCTGATCATTACCCCTGC
TGAGGATGGATATAACTGGAGGAAATATGGACAGAAGCAAGTTAAGAACAGTGAGCATCC
CAGAAGCTACTACAAATGCACTTTCACGAATTGCGCTGTCAAGAAGGTGGAGCGTTCTCA
AGATGGCCAAATAACAGAGATAGTCTACAAAGGTTCTCACAATCACCCTTTGCCGCCTTC
CAACCGCCGACCAAATGTTCCTTTCTCACACTTCAATGATCTGAGAGATGATCACTCTGA
GAAATTTGGTTCCAAGTCTGGTCAGGCCACAGCAACTTCATGGGAGAATGCCGCAAATGG
ACACCTCCAAGATGTCGGTAGTGAAGTTCTGACAAAACTGTCTGCTTCTCTTACGACAAC
AGAACATGCTGAAAAATCTGTTATGGACAAACAAGAAGCTGTGGATATCTCATCGACGCT
CTCCAATGAAGAGGATGATAGGGTAACGCATCGTGCCCCGCTTTCTCTGGGCTTTGATGC
GAACGATGACTATGTTGAACACAAGAGAAGAAAGATGGATGTTTATGCCGCTACTAGCAC
TAGCACCAACGCCATCGACATAGGAGCTGTGGCGTCAAGAGCTATCCGGGAGCCTCGCGT
TGTTGTTCAGACCACAAGTGAGGTTGACATCCTTGATGATGGTTACCGTTGGCGCAAGTA
TGGGCAGAAAGTTGTCAAAGGAAACCCAAATCCAAGGAGCTACTACAAGTGCACTCATCC
GGGTTGCTCGGTGCGCAAGCATGTGGAGCGATCATCGCATGATCTGAAATCCGTCATCAC
GACGTATGAAGGAAAGCACAACCATGAAGTTCCAGCTGCCAGGAACAGTGGCCACCCAAG
CTCAGGCTCAGCCGCTGCACCACAGGCTACCAATGGTCTTCTTCACCGGAGACCTGAACC
GGCACAAGGTGGTGGTGGTGGTAGCCTTGCTCAGTTTGGCTATGGCTCAGCTGGTCACAG
ACCAGCAGAGCAGTTTGGTGCAGCAGCAGCTGGTTTCTCCTTTGGAATGCTGCCTCGTAG
CATTGCAACTCCGGCGCCGTCTCCGGCGATCGCCGTGCCGGCGATGCAGGGGTACCCAGG
GCTTGTGCTGCCGAGAGGTGAGATGAAGGTGAACTTGCTGCCACAGTCTGGGAATGCTGG
TGCAGCAGCTAGCCAGCAGCTGATGGGCAGGTTGCCAAAGCAGCATCCTCAGATGTAAAA
ATGGCAGGAACATGAGACAAATGGTGTTTGCTGCTTATGTATATGAAACATTTTTGGTGC
TTTTGTTAGGAGAATGGAGTGTTATTGTAGCTCAATTTACTTTCGGGGGAAAAAAAAGCA
GATAGTTCAGGC

CDS

2025 bp

>Os08t0499300-01 WRKY transcription factor, Disease resistance against X. oryzae, Drought tolerance
ATGGACGGGACCAACAACCATGGAGCACTGATGGACGATTGGATGCTTCCCTCACCCAGT
CCAAGAACACTCATGTCGAGTTTCTTGAACGAAGAATTCAGCTCCGGTCCCTTTTCAGAC
ATTTTCTGTGATAATGGCAGTAACAAACATCAGGATGGACTTGGGAAGAGCAAAGCTTTC
ATCGATTCAAGCCGGGAAGAAACTGCTCAGCTAGCAAAAAAGTTTGAATCAAACCTTTTT
GGTGCCAACCAGAAATCAAGCTCAAATGGCTGTCTGTCAGAGAGGATGGCTGCAAGGACA
GGTTTTGGTGTCCTGAAAATTGATACATCTCGTGTCGGTTATTCTACACCGATTCGGTCT
CCGGTGACGATCCCGCCCGGTGTGAGTCCAAGGGAACTTCTTGAGTCGCCGGTTTTTCTT
CCGAACGCCATTGCACAACCTTCTCCTACCACTGGCAAACTGCCATTTTTGATGCATAGT
AATGTTAAACCATCGATCCCTAAAAAAACTGAAGATGAAACACGCCATGATCGTGTATTC
TTCTTTCAACCCATTTTGGGATCTAAGCCACCAACTTGTCCAGTTGCAGAGAAGGGTTTC
AGTGTTAATCATCAAAACCAGCCTTCAGTGACGGATAATCACCAGGAGCTCAGTCTTCAG
TCTAGCTCAACTGCAGCCAAGGATTTCACTTCAGCAACTATTGTTAAACCTaagacatct
gattccatgttagacaatgatgatcacccttcccctgcaaatgatcaagaagagaatgca
acaaacaaaaatgaagagtattcttcagaCCTGATCATTACCCCTGCTGAGGATGGATAT
AACTGGAGGAAATATGGACAGAAGCAAGTTAAGAACAGTGAGCATCCCAGAAGCTACTAC
AAATGCACTTTCACGAATTGCGCTGTCAAGAAGGTGGAGCGTTCTCAAGATGGCCAAATA
ACAGAGATAGTCTACAAAGGTTCTCACAATCACCCTTTGCCGCCTTCCAACCGCCGACCA
AATGTTCCTTTCTCACACTTCAATGATCTGAGAGATGATCACTCTGAGAAATTTGGTTCC
AAGTCTGGTCAGGCCACAGCAACTTCATGGGAGAATGCCGCAAATGGACACCTCCAAGAT
GTCGGTAGTGAAGTTCTGACAAAACTGTCTGCTTCTCTTACGACAACAGAACATGCTGAA
AAATCTGTTATGGACAAACAAGAAGCTGTGGATATCTCATCGACGCTCTCCAATGAAGAG
GATGATAGGGTAACGCATCGTGCCCCGCTTTCTCTGGGCTTTGATGCGAACGATGACTAT
GTTGAACACAAGAGAAGAAAGATGGATGTTTATGCCGCTACTAGCACTAGCACCAACGCC
ATCGACATAGGAGCTGTGGCGTCAAGAGCTATCCGGGAGCCTCGCGTTGTTGTTCAGACC
ACAAGTGAGGTTGACATCCTTGATGATGGTTACCGTTGGCGCAAGTATGGGCAGAAAGTT
GTCAAAGGAAACCCAAATCCAAGGAGCTACTACAAGTGCACTCATCCGGGTTGCTCGGTG
CGCAAGCATGTGGAGCGATCATCGCATGATCTGAAATCCGTCATCACGACGTATGAAGGA
AAGCACAACCATGAAGTTCCAGCTGCCAGGAACAGTGGCCACCCAAGCTCAGGCTCAGCC
GCTGCACCACAGGCTACCAATGGTCTTCTTCACCGGAGACCTGAACCGGCACAAGGTGGT
GGTGGTGGTAGCCTTGCTCAGTTTGGCTATGGCTCAGCTGGTCACAGACCAGCAGAGCAG
TTTGGTGCAGCAGCAGCTGGTTTCTCCTTTGGAATGCTGCCTCGTAGCATTGCAACTCCG
GCGCCGTCTCCGGCGATCGCCGTGCCGGCGATGCAGGGGTACCCAGGGCTTGTGCTGCCG
AGAGGTGAGATGAAGGTGAACTTGCTGCCACAGTCTGGGAATGCTGGTGCAGCAGCTAGC
CAGCAGCTGATGGGCAGGTTGCCAAAGCAGCATCCTCAGATGTAA

Protein

675 aa

>Os08t0499300-01 WRKY transcription factor, Disease resistance against X. oryzae, Drought tolerance
MDGTNNHGALMDDWMLPSPSPRTLMSSFLNEEFSSGPFSDIFCDNGSNKHQDGLGKSKAF
IDSSREETAQLAKKFESNLFGANQKSSSNGCLSERMAARTGFGVLKIDTSRVGYSTPIRS
PVTIPPGVSPRELLESPVFLPNAIAQPSPTTGKLPFLMHSNVKPSIPKKTEDETRHDRVF
FFQPILGSKPPTCPVAEKGFSVNHQNQPSVTDNHQELSLQSSSTAAKDFTSATIVKPKTS
DSMLDNDDHPSPANDQEENATNKNEEYSSDLIITPAEDGYNWRKYGQKQVKNSEHPRSYY
KCTFTNCAVKKVERSQDGQITEIVYKGSHNHPLPPSNRRPNVPFSHFNDLRDDHSEKFGS
KSGQATATSWENAANGHLQDVGSEVLTKLSASLTTTEHAEKSVMDKQEAVDISSTLSNEE
DDRVTHRAPLSLGFDANDDYVEHKRRKMDVYAATSTSTNAIDIGAVASRAIREPRVVVQT
TSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERSSHDLKSVITTYEG
KHNHEVPAARNSGHPSSGSAAAPQATNGLLHRRPEPAQGGGGGSLAQFGYGSAGHRPAEQ
FGAAAAGFSFGMLPRSIATPAPSPAIAVPAMQGYPGLVLPRGEMKVNLLPQSGNAGAAAS
QQLMGRLPKQHPQM*

5'UTR

chr08:24649666..24649832 (- strand) : 167 bp

chr08:24648815..24648840 (- strand) : 26 bp

CDS

chr08:24648383..24648814 (- strand) : 432 bp

chr08:24647951..24648112 (- strand) : 162 bp

chr08:24647043..24647785 (- strand) : 743 bp

chr08:24646770..24646955 (- strand) : 186 bp

chr08:24646066..24646567 (- strand) : 502 bp

3'UTR

chr08:24645932..24646065 (- strand) : 134 bp

FASTA

>Os08t0499300-01 class=Sequence position=chr08:24645932..24649832 (- strand)
TCCTTCGCTT CACCACCTCG CCAAAACCGC CTTCCCTTCC CTTCTCTTCC CTTCCAACCT CTCGTTGCGG TTTGCGCTAG
AAAAAAAAGA GAGGAGAGAT TTCAAGAAAC CGTGGGGGAG AAAGAAGCAG GCAAGAAGTA GCAGCAGCAG CGAGTGAGGC
TAATCTGGTC AGTTTCAGAA CAGATTCTTT GTTCGGTCTC TATCCATTGC AAGAACAGGT TTTGTTTTTT CTTTTCCCTT
TTTTTGGGAT CAGAGTCTCT CCATTTCTGA TGCTGCTGCT GCTGCTGATG ATGATGATGA TGCAAGGCTT GTGGCAACTT
GTTTGGTGAA AGAACAACGA GAGGGATACT GGGATAGGGA TCAAAGGCAA AGGTTTTTGT TTTTACCCCG TGGTAATTGT
TCGTTCGGTT TGTGATGGGA TAGTTGCTGG GACTGTGAAT CATTTTGCCC CTTCTTATCA TACAGACAGG CGCGTGATTT
GACCAGCTTG TCGTCTCTGC TCTGCCTCTA TCCATCCATC CATTCATACA TCCAACCTTG GGGGTTCTTG ATTCTTTTTC
TCATTTCTTG GGGAGGCTTA ATTGTTGCTA TCGCCCTCCG CTTCAGGTGT CCATTTGAAT TCTTCGTCGT TTCTTTCGTA
TTTAATTGCC ATTTGCTGAT TTGCCTCTTT ATTTCGGTGG GTTTTATGGT AATAAAGGTG TGGTTCCTTT ATCATCAAAT
TTGAGGTGTT CTGGGTTTTC TTTGGTTCTT TTTTGGAGCA CTGGATTTGT GTGCTCTTGT AAATCAAATA GAGTTTGTGG
TTTGGTTCGT ATTTTACACA ATCGAGTTGT GTTTTTATTT TAGTTTGTAT CGAAATATTT GCATACTTGT TTCTAGTTCC
TTCAGGCTTC AGTTCTCTTC ATTATTATAA AAAAAAATTT GGTCCTTTCG TCCATAATTT TTTTCACAAT TCCATTTTTG
AATGTATGAG CTTGAATTAT GTGACTTTTC AGTTTGAGCT TGGGATTGTC ACCTTTTCAT GGACGGGACC AACAACCATG
GAGCACTGAT GGACGATTGG ATGCTTCCCT CACCCAGTCC AAGAACACTC ATGTCGAGTT TCTTGAACGA AGAATTCAGC
TCCGGTCCCT TTTCAGACAT TTTCTGTGAT AATGGCAGTA ACAAACATCA GGATGGACTT GGGAAGAGCA AAGCTTTCAT
CGATTCAAGC CGGGAAGAAA CTGCTCAGCT AGCAAAAAAG TTTGAATCAA ACCTTTTTGG TGCCAACCAG AAATCAAGCT
CAAATGGCTG TCTGTCAGAG AGGATGGCTG CAAGGACAGG TTTTGGTGTC CTGAAAATTG ATACATCTCG TGTCGGTTAT
TCTACACCGA TTCGGTCTCC GGTGACGATC CCGCCCGGTG TGAGTCCAAG GGAACTTCTT GAGTCGCCGG TTTTTCTTCC
GAACGCCATT GTAAGTGACT TCCTCACCTC AATCAGTATT TGCTCTGTGT AATGTTCAGT TACTCTACTC ATGTGGTTTA
TATGGAGGAT ATATTTGTCA GTAAATGGTG AAATCTAAAC CAAGATACCT ATTATAAAAA ATATTCTAAC GCAAGATACA
GCATCTTTAA TTTCTCTTAT GTCTCTGCAG CTTCGTATAA TTAGTGGAAT TTTGGAGAAG AAAGTGACTA TATATGTTGA
TGACTGATTA ATCTTAATGT CATGGTTTTG ATTTATGCAG GCACAACCTT CTCCTACCAC TGGCAAACTG CCATTTTTGA
TGCATAGTAA TGTTAAACCA TCGATCCCTA AAAAAACTGA AGATGAAACA CGCCATGATC GTGTATTCTT CTTTCAACCC
ATTTTGGGAT CTAAGCCACC AACTTGTCCA GTTGCAGAGA AGGTAGTTTT CTCAAACAAT GTTGTTCTAT TCCCTATTTA
CTGCAAATCT GTAATCACTG CTCGCCTGCT CGGCGCAGTT TGTTTTACTG TTCCAGCAAA TCTGACGAGC AAAATCAAAT
TATCAGTGTT TTTTATGCAT TGGTCTGATG ATATTTATAC TTTTCAGGGT TTCAGTGTTA ATCATCAAAA CCAGCCTTCA
GTGACGGATA ATCACCAGGA GCTCAGTCTT CAGTCTAGCT CAACTGCAGC CAAGGATTTC ACTTCAGCAA CTATTGTTAA
ACCTaagaca tctgattcca tgttagacaa tgatgatcac ccttcccctg caaatgatca agaagagaat gcaacaaaca
aaaatgaaga gtattcttca gaCCTGATCA TTACCCCTGC TGAGGATGGA TATAACTGGA GGAAATATGG ACAGAAGCAA
GTTAAGAACA GTGAGCATCC CAGAAGCTAC TACAAATGCA CTTTCACGAA TTGCGCTGTC AAGAAGGTGG AGCGTTCTCA
AGATGGCCAA ATAACAGAGA TAGTCTACAA AGGTTCTCAC AATCACCCTT TGCCGCCTTC CAACCGCCGA CCAAATGTTC
CTTTCTCACA CTTCAATGAT CTGAGAGATG ATCACTCTGA GAAATTTGGT TCCAAGTCTG GTCAGGCCAC AGCAACTTCA
TGGGAGAATG CCGCAAATGG ACACCTCCAA GATGTCGGTA GTGAAGTTCT GACAAAACTG TCTGCTTCTC TTACGACAAC
AGAACATGCT GAAAAATCTG TTATGGACAA ACAAGAAGCT GTGGATATCT CATCGACGCT CTCCAATGAA GAGGATGATA
GGGTAACGCA TCGTGCCCCG CTTTCTCTGG GCTTTGATGC GAACGATGAC TATGTTGAAC ACAAGAGAAG GTTGGCTAGC
CTTAGTCACT AATCACTCAA TGAACCAATC TTCACTTTGA GTAGCTGATT GTTTTCCTTC AATTTTATTC ATTTCAGAAA
GATGGATGTT TATGCCGCTA CTAGCACTAG CACCAACGCC ATCGACATAG GAGCTGTGGC GTCAAGAGCT ATCCGGGAGC
CTCGCGTTGT TGTTCAGACC ACAAGTGAGG TTGACATCCT TGATGATGGT TACCGTTGGC GCAAGTATGG GCAGAAAGTT
GTCAAAGGAA ACCCAAATCC AAGGTCAATT CTAATGCCAT TTTTCTCTTT TGGAACAAAT TCTTTGCAGT TCCTCTAATC
CTTCACTACA AAAGTAAATG TTTAGCTTCA CAATATGACA CTGTCATCGA AGGAACATTT CTCTGTCCAT ATGTGTGCAT
CCATAGTTGG TACAAAGACC GGAAATTACT CGCATTATCT AAAAAACTCC ATTTTGTATT TGCAGGAGCT ACTACAAGTG
CACTCATCCG GGTTGCTCGG TGCGCAAGCA TGTGGAGCGA TCATCGCATG ATCTGAAATC CGTCATCACG ACGTATGAAG
GAAAGCACAA CCATGAAGTT CCAGCTGCCA GGAACAGTGG CCACCCAAGC TCAGGCTCAG CCGCTGCACC ACAGGCTACC
AATGGTCTTC TTCACCGGAG ACCTGAACCG GCACAAGGTG GTGGTGGTGG TAGCCTTGCT CAGTTTGGCT ATGGCTCAGC
TGGTCACAGA CCAGCAGAGC AGTTTGGTGC AGCAGCAGCT GGTTTCTCCT TTGGAATGCT GCCTCGTAGC ATTGCAACTC
CGGCGCCGTC TCCGGCGATC GCCGTGCCGG CGATGCAGGG GTACCCAGGG CTTGTGCTGC CGAGAGGTGA GATGAAGGTG
AACTTGCTGC CACAGTCTGG GAATGCTGGT GCAGCAGCTA GCCAGCAGCT GATGGGCAGG TTGCCAAAGC AGCATCCTCA
GATGTAAAAA TGGCAGGAAC ATGAGACAAA TGGTGTTTGC TGCTTATGTA TATGAAACAT TTTTGGTGCT TTTGTTAGGA
GAATGGAGTG TTATTGTAGC TCAATTTACT TTCGGGGGAA AAAAAAGCAG ATAGTTCAGG C

Locus: Os08g0499300

Loading...

Locus: Os08g0499300

Loading...