Os08t0499300-02

Locus

Os08g0499300

Description

Similar to WRKY transcription factor 42 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY30

CGSNL Gene Name

WRKY GENE 30

Oryzabase Gene Symbol Synonym(s)

OsWRKY30

Oryzabase Gene Name Synonym(s)

Rice WRKY gene30

Transcript Evidence

AK062027 (DDBJ, Best hit)

Protein Evidence

B2KJ82 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

DNA-binding WRKY (IPR003657)

Full-length cDNA

001-043-G06 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0499300-02)

Others

Oryzabase (6543)

Transcript

1286 bp

>Os08t0499300-02 Similar to WRKY transcription factor 42 (Fragment).
AACAGTGAGCATCCCAGAAGCTACTACAAATGCACTTTCACGAATTGCGCTGTCAAGAAG
GTGGAGCGTTCTCAAGATGGCCAAATAACAGAGATAGTCTACAAAGGTTCTCACAATCAC
CCTTTGCCGCCTTCCAACCGCCGACCAAATGTTCCTTTCTCACACTTCAATGATCTGAGA
GATGATCACTCTGAGAAATTTGGTTCCAAGTCTGGTCAGGCCACAGCAACTTCATGGGAG
AATGCCGCAAATGGACACCTCCAAGATGTCGGTAGTGAAGTTCTGACAAAACTGTCTGCT
TCTCTTACGACAACAGAACATGCTGAAAAATCTGTTATGGACAAACAAGAAGCTGTGGAT
ATCTCATCGACGCTCTCCAATGAAGAGGATGATAGGGTAACGCATCGTGCCCCGCTTTCT
CTGGGCTTTGATGCGAACGATGACTATGTTGAACACAAGAGAAGAAAGATGGATGTTTAT
GCCGCTACTAGCACTAGCACCAACGCCATCGACATAGGAGCTGTGGCGTCAAGAGCTATC
CGGGAGCCTCGCGTTGTTGTTCAGACCACAAGTGAGGTTGACATCCTTGATGATGGTTAC
CGTTGGCGCAAGTATGGGCAGAAAGTTGTCAAAGGAAACCCAAATCCAAGGAGCTACTAC
AAGTGCACTCATCCGGGTTGCTCGGTGCGCAAGCATGTGGAGCGATCATCGCATGATCTG
AAATCCGTCATCACGACGTATGAAGGAAAGCACAACCATGAAGTTCCAGCTGCCAGGAAC
AGTGGCCACCCAAGCTCAGGCTCAGCCGCTGCACCACAGGCTACCAATGGTCTTCTTCAC
CGGAGACCTGAACCGGCACAAGGTGGTGGTGGTGGTAGCCTTGCTCAGTTTGGCTATGGC
TCAGCTGGTCACAGACCAGCAGAGCAGTTTGGTGCAGCAGCAGCTGGTTTCTCCTTTGGA
ATGCTGCCTCGTAGCATTGCAACTCCGGCGCCGTCTCCGGCGATCGCCGTGCCGGCGATG
CAGGGGTACCCAGGGCTTGTGCTGCCGAGAGGTGAGATGAAGGTGAACTTGCTGCCACAG
TCTGGGAATGCTGGTGCAGCAGCTAGCCAGCAGCTGATGGGCAGGTTGCCAAAGCAGCAT
CCTCAGATGTAAAAATGGCAGGAACATGAGACAAATGGTGTTTGCTGCTTATGTATATGA
AACATTTTTGGTGCTTTTGTTAGGAGAATGGAGTGTTATTGTAGCTCAATTTACTTTCGG
GGGAAAAAAAAGCAGATAGTTCAGGC

CDS

1152 bp

>Os08t0499300-02 Similar to WRKY transcription factor 42 (Fragment).
AACAGTGAGCATCCCAGAAGCTACTACAAATGCACTTTCACGAATTGCGCTGTCAAGAAG
GTGGAGCGTTCTCAAGATGGCCAAATAACAGAGATAGTCTACAAAGGTTCTCACAATCAC
CCTTTGCCGCCTTCCAACCGCCGACCAAATGTTCCTTTCTCACACTTCAATGATCTGAGA
GATGATCACTCTGAGAAATTTGGTTCCAAGTCTGGTCAGGCCACAGCAACTTCATGGGAG
AATGCCGCAAATGGACACCTCCAAGATGTCGGTAGTGAAGTTCTGACAAAACTGTCTGCT
TCTCTTACGACAACAGAACATGCTGAAAAATCTGTTATGGACAAACAAGAAGCTGTGGAT
ATCTCATCGACGCTCTCCAATGAAGAGGATGATAGGGTAACGCATCGTGCCCCGCTTTCT
CTGGGCTTTGATGCGAACGATGACTATGTTGAACACAAGAGAAGAAAGATGGATGTTTAT
GCCGCTACTAGCACTAGCACCAACGCCATCGACATAGGAGCTGTGGCGTCAAGAGCTATC
CGGGAGCCTCGCGTTGTTGTTCAGACCACAAGTGAGGTTGACATCCTTGATGATGGTTAC
CGTTGGCGCAAGTATGGGCAGAAAGTTGTCAAAGGAAACCCAAATCCAAGGAGCTACTAC
AAGTGCACTCATCCGGGTTGCTCGGTGCGCAAGCATGTGGAGCGATCATCGCATGATCTG
AAATCCGTCATCACGACGTATGAAGGAAAGCACAACCATGAAGTTCCAGCTGCCAGGAAC
AGTGGCCACCCAAGCTCAGGCTCAGCCGCTGCACCACAGGCTACCAATGGTCTTCTTCAC
CGGAGACCTGAACCGGCACAAGGTGGTGGTGGTGGTAGCCTTGCTCAGTTTGGCTATGGC
TCAGCTGGTCACAGACCAGCAGAGCAGTTTGGTGCAGCAGCAGCTGGTTTCTCCTTTGGA
ATGCTGCCTCGTAGCATTGCAACTCCGGCGCCGTCTCCGGCGATCGCCGTGCCGGCGATG
CAGGGGTACCCAGGGCTTGTGCTGCCGAGAGGTGAGATGAAGGTGAACTTGCTGCCACAG
TCTGGGAATGCTGGTGCAGCAGCTAGCCAGCAGCTGATGGGCAGGTTGCCAAAGCAGCAT
CCTCAGATGTAA

Protein

384 aa

>Os08t0499300-02 Similar to WRKY transcription factor 42 (Fragment).
NSEHPRSYYKCTFTNCAVKKVERSQDGQITEIVYKGSHNHPLPPSNRRPNVPFSHFNDLR
DDHSEKFGSKSGQATATSWENAANGHLQDVGSEVLTKLSASLTTTEHAEKSVMDKQEAVD
ISSTLSNEEDDRVTHRAPLSLGFDANDDYVEHKRRKMDVYAATSTSTNAIDIGAVASRAI
REPRVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERSSHDL
KSVITTYEGKHNHEVPAARNSGHPSSGSAAAPQATNGLLHRRPEPAQGGGGGSLAQFGYG
SAGHRPAEQFGAAAAGFSFGMLPRSIATPAPSPAIAVPAMQGYPGLVLPRGEMKVNLLPQ
SGNAGAAASQQLMGRLPKQHPQM*

CDS

chr08:24647043..24647506 (- strand) : 464 bp

chr08:24646770..24646955 (- strand) : 186 bp

chr08:24646066..24646567 (- strand) : 502 bp

3'UTR

chr08:24645932..24646065 (- strand) : 134 bp

FASTA

>Os08t0499300-02 class=Sequence position=chr08:24645932..24647506 (- strand)
AACAGTGAGC ATCCCAGAAG CTACTACAAA TGCACTTTCA CGAATTGCGC TGTCAAGAAG GTGGAGCGTT CTCAAGATGG
CCAAATAACA GAGATAGTCT ACAAAGGTTC TCACAATCAC CCTTTGCCGC CTTCCAACCG CCGACCAAAT GTTCCTTTCT
CACACTTCAA TGATCTGAGA GATGATCACT CTGAGAAATT TGGTTCCAAG TCTGGTCAGG CCACAGCAAC TTCATGGGAG
AATGCCGCAA ATGGACACCT CCAAGATGTC GGTAGTGAAG TTCTGACAAA ACTGTCTGCT TCTCTTACGA CAACAGAACA
TGCTGAAAAA TCTGTTATGG ACAAACAAGA AGCTGTGGAT ATCTCATCGA CGCTCTCCAA TGAAGAGGAT GATAGGGTAA
CGCATCGTGC CCCGCTTTCT CTGGGCTTTG ATGCGAACGA TGACTATGTT GAACACAAGA GAAGGTTGGC TAGCCTTAGT
CACTAATCAC TCAATGAACC AATCTTCACT TTGAGTAGCT GATTGTTTTC CTTCAATTTT ATTCATTTCA GAAAGATGGA
TGTTTATGCC GCTACTAGCA CTAGCACCAA CGCCATCGAC ATAGGAGCTG TGGCGTCAAG AGCTATCCGG GAGCCTCGCG
TTGTTGTTCA GACCACAAGT GAGGTTGACA TCCTTGATGA TGGTTACCGT TGGCGCAAGT ATGGGCAGAA AGTTGTCAAA
GGAAACCCAA ATCCAAGGTC AATTCTAATG CCATTTTTCT CTTTTGGAAC AAATTCTTTG CAGTTCCTCT AATCCTTCAC
TACAAAAGTA AATGTTTAGC TTCACAATAT GACACTGTCA TCGAAGGAAC ATTTCTCTGT CCATATGTGT GCATCCATAG
TTGGTACAAA GACCGGAAAT TACTCGCATT ATCTAAAAAA CTCCATTTTG TATTTGCAGG AGCTACTACA AGTGCACTCA
TCCGGGTTGC TCGGTGCGCA AGCATGTGGA GCGATCATCG CATGATCTGA AATCCGTCAT CACGACGTAT GAAGGAAAGC
ACAACCATGA AGTTCCAGCT GCCAGGAACA GTGGCCACCC AAGCTCAGGC TCAGCCGCTG CACCACAGGC TACCAATGGT
CTTCTTCACC GGAGACCTGA ACCGGCACAA GGTGGTGGTG GTGGTAGCCT TGCTCAGTTT GGCTATGGCT CAGCTGGTCA
CAGACCAGCA GAGCAGTTTG GTGCAGCAGC AGCTGGTTTC TCCTTTGGAA TGCTGCCTCG TAGCATTGCA ACTCCGGCGC
CGTCTCCGGC GATCGCCGTG CCGGCGATGC AGGGGTACCC AGGGCTTGTG CTGCCGAGAG GTGAGATGAA GGTGAACTTG
CTGCCACAGT CTGGGAATGC TGGTGCAGCA GCTAGCCAGC AGCTGATGGG CAGGTTGCCA AAGCAGCATC CTCAGATGTA
AAAATGGCAG GAACATGAGA CAAATGGTGT TTGCTGCTTA TGTATATGAA ACATTTTTGG TGCTTTTGTT AGGAGAATGG
AGTGTTATTG TAGCTCAATT TACTTTCGGG GGAAAAAAAA GCAGATAGTT CAGGC

Locus: Os08g0499300

Loading...

Locus: Os08g0499300

Loading...