Os08t0505900-01

Locus

Os08g0505900

Description

Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response

RAP-DB Gene Symbol Synonym(s)

PGIP6, Ospgip6, pgip6, OsPGIP6

RAP-DB Gene Name Synonym(s)

POLYGALACTURONASE-INHIBITING PROTEIN 6, Polygalacturonase-inhibiting protein 6, polygalacturonase inhibiting protein 6

CGSNL Gene Symbol

PGIP6

CGSNL Gene Name

POLYGALACTURONASE-INHIBITING PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

Ospgip6, pgip6, OsPGIP6

Oryzabase Gene Name Synonym(s)

Polygalacturonase-inhibiting protein 6, polygalacturonase inhibiting protein 6

Transcript Evidence

AK060670

AK120866

AK120908

Protein Evidence

Q6Z3T9

Literature

PMID: 22362377

Note

Manual Curation

April 15, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat domain, L domain-like (IPR032675)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Leucine-rich repeat (IPR001611)

Full-length cDNA

001-028-G04 (Online Clone Ordering)

J023025G09 (Online Clone Ordering)

J023031M05 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0505900-01)

RiceXPro (AK060670)

Others

Oryzabase (10382)

KEGG (Os08t0505900-01)

Transcript

1562 bp

>Os08t0505900-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
ACTCTCACTCTGCAGTGCAGTGCCCACGCGAGCCGAGACGAGACGATGGCATCATCTCCC
GCTCCAAGCCCCGCCGCGCCGCCGCTCCTCCTCGCCGCGCTCGCGGCGCTCGCCGTGGTC
GCGTCCGCCTCCGCCGCCGCGTGCTCCGCGGGCGACCGGGACGCGCTGCTGGCGATCCGG
GCGGCGCTGTCGGAGGCGCACCTCGGGGTGTTCTCGTCGTGGACGGGCACCGACTGCTGC
ACCAGCTGGTACGGCGTGAGCTGCGATCCCACCACCGGCCGCGTCGCCGACCTCACCCTC
CGCGGCGAGGCCGACGACCCCGTCATGGCGCCCGCCGGCCGCCCGGCCTCCGGCGTCATG
TCCGGCTACATCTCCGACGCGGTGTGCCGCCTCGGCCGCCTCTCCTCCCTCATCCTCGCC
GACTGGAAGCAGATCTCCGGGCCCATCCCGCCGTGCGTCGCCACCGCCCTCCCTTACCTC
CGCATCCTCGAGCTCCCCGGCAACCGCCTCACCGGCGAGATCCCGCGCTCCATCGGCAGC
CTCTCCCGCCTCACCGTGCTCAACCTCGCCGACAACCTCATCGCCGGCGAAATCCCAAGC
TCCATCACCTCGCTCGCGTCGCTGAAGCACCTCGACCTCACCAACAACCAGCTCACCGGC
GGGATCCCGGACGACGTGGGCGACCTCACCATGCTCAGCCGCGCGCTGCTCGGCCGGAAC
AAGCTCACCGGCGCCATCCCAACGTCGGTCGGCTCCCTGACCCGGCTCGCCGACCTCGAC
CTCGCCGAGAACGGCCTCACCGGCGGGATCCCGGACAGCCTGGGCGGCGCCCACGTGCTC
ACCTCCCTGTACCTCGGCGGCAACCGGGTCTCCGGCCGGATCCCGGCGAGCCTGCTGCAG
AACAAGGGGCTGGGCATCCTGAACCTGAGCCGGAACGCCGTCGAGGGCGCCATCCCCGAC
GTGTTCACCGCCGAGTCCTACTTCATGGTGCTCGACCTGTCCCGGAACAGGCTCACCGGC
GCCGTGCCGAGGTCGCTGTCGGCGGCAGCGTACGTCGGCCACCTCGACCTCAGCCACAAC
CGGCTGTGCGGCTCCATCCCCGCCGGCCCGCCGTTCGACCACCTCGACGCCGCCTCCTTC
GCCAGCAACAGCTGCCTCTGCGGCGGCCCGCTCGGCAAGTGCACGTGACGTGCCCCAACC
AGAGCCGTCCGATCGATCGGGAGAGCCTGATCGAACGTGTGGTGTGCGATGTACCGTGTA
CGATGCAACGAACTTACGTGTTCGTATATATGGTTAATTAGTTGCTGCTTAAGTATTAAC
TCACTTGGGCTATAGTTTTGGGCTTGGGTACATATAGAACAAGATGAGAATTTGTGCCTA
GTGTGTGTGTGTGTGAGAGAAAGAGGAAGTGGTTAAGGAAAAGAAGAATGTTTTCTCTTT
CCTGCCTTTCTCTTCTTTATACTTTTAACCTTTTTTGCTAGTGATTTACTTGATAGTTCT
ACTTTAAAGTTTGTATTGTACAAGTGACAAAAGCATAAGAAATGCTAAAGATCTTGTATG
AG

CDS

1143 bp

>Os08t0505900-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
ATGGCATCATCTCCCGCTCCAAGCCCCGCCGCGCCGCCGCTCCTCCTCGCCGCGCTCGCG
GCGCTCGCCGTGGTCGCGTCCGCCTCCGCCGCCGCGTGCTCCGCGGGCGACCGGGACGCG
CTGCTGGCGATCCGGGCGGCGCTGTCGGAGGCGCACCTCGGGGTGTTCTCGTCGTGGACG
GGCACCGACTGCTGCACCAGCTGGTACGGCGTGAGCTGCGATCCCACCACCGGCCGCGTC
GCCGACCTCACCCTCCGCGGCGAGGCCGACGACCCCGTCATGGCGCCCGCCGGCCGCCCG
GCCTCCGGCGTCATGTCCGGCTACATCTCCGACGCGGTGTGCCGCCTCGGCCGCCTCTCC
TCCCTCATCCTCGCCGACTGGAAGCAGATCTCCGGGCCCATCCCGCCGTGCGTCGCCACC
GCCCTCCCTTACCTCCGCATCCTCGAGCTCCCCGGCAACCGCCTCACCGGCGAGATCCCG
CGCTCCATCGGCAGCCTCTCCCGCCTCACCGTGCTCAACCTCGCCGACAACCTCATCGCC
GGCGAAATCCCAAGCTCCATCACCTCGCTCGCGTCGCTGAAGCACCTCGACCTCACCAAC
AACCAGCTCACCGGCGGGATCCCGGACGACGTGGGCGACCTCACCATGCTCAGCCGCGCG
CTGCTCGGCCGGAACAAGCTCACCGGCGCCATCCCAACGTCGGTCGGCTCCCTGACCCGG
CTCGCCGACCTCGACCTCGCCGAGAACGGCCTCACCGGCGGGATCCCGGACAGCCTGGGC
GGCGCCCACGTGCTCACCTCCCTGTACCTCGGCGGCAACCGGGTCTCCGGCCGGATCCCG
GCGAGCCTGCTGCAGAACAAGGGGCTGGGCATCCTGAACCTGAGCCGGAACGCCGTCGAG
GGCGCCATCCCCGACGTGTTCACCGCCGAGTCCTACTTCATGGTGCTCGACCTGTCCCGG
AACAGGCTCACCGGCGCCGTGCCGAGGTCGCTGTCGGCGGCAGCGTACGTCGGCCACCTC
GACCTCAGCCACAACCGGCTGTGCGGCTCCATCCCCGCCGGCCCGCCGTTCGACCACCTC
GACGCCGCCTCCTTCGCCAGCAACAGCTGCCTCTGCGGCGGCCCGCTCGGCAAGTGCACG
TGA

Protein

380 aa

>Os08t0505900-01 Leucine-rich repeat (LRR) protein, Inhibitor of fungal polygalacturonase, Defence response
MASSPAPSPAAPPLLLAALAALAVVASASAAACSAGDRDALLAIRAALSEAHLGVFSSWT
GTDCCTSWYGVSCDPTTGRVADLTLRGEADDPVMAPAGRPASGVMSGYISDAVCRLGRLS
SLILADWKQISGPIPPCVATALPYLRILELPGNRLTGEIPRSIGSLSRLTVLNLADNLIA
GEIPSSITSLASLKHLDLTNNQLTGGIPDDVGDLTMLSRALLGRNKLTGAIPTSVGSLTR
LADLDLAENGLTGGIPDSLGGAHVLTSLYLGGNRVSGRIPASLLQNKGLGILNLSRNAVE
GAIPDVFTAESYFMVLDLSRNRLTGAVPRSLSAAAYVGHLDLSHNRLCGSIPAGPPFDHL
DAASFASNSCLCGGPLGKCT*

5'UTR

chr08:25017319..25017363 (- strand) : 45 bp

CDS

chr08:25016176..25017318 (- strand) : 1143 bp

3'UTR

chr08:25015802..25016175 (- strand) : 374 bp

FASTA

>Os08t0505900-01 class=Sequence position=chr08:25015802..25017363 (- strand)
ACTCTCACTC TGCAGTGCAG TGCCCACGCG AGCCGAGACG AGACGATGGC ATCATCTCCC GCTCCAAGCC CCGCCGCGCC
GCCGCTCCTC CTCGCCGCGC TCGCGGCGCT CGCCGTGGTC GCGTCCGCCT CCGCCGCCGC GTGCTCCGCG GGCGACCGGG
ACGCGCTGCT GGCGATCCGG GCGGCGCTGT CGGAGGCGCA CCTCGGGGTG TTCTCGTCGT GGACGGGCAC CGACTGCTGC
ACCAGCTGGT ACGGCGTGAG CTGCGATCCC ACCACCGGCC GCGTCGCCGA CCTCACCCTC CGCGGCGAGG CCGACGACCC
CGTCATGGCG CCCGCCGGCC GCCCGGCCTC CGGCGTCATG TCCGGCTACA TCTCCGACGC GGTGTGCCGC CTCGGCCGCC
TCTCCTCCCT CATCCTCGCC GACTGGAAGC AGATCTCCGG GCCCATCCCG CCGTGCGTCG CCACCGCCCT CCCTTACCTC
CGCATCCTCG AGCTCCCCGG CAACCGCCTC ACCGGCGAGA TCCCGCGCTC CATCGGCAGC CTCTCCCGCC TCACCGTGCT
CAACCTCGCC GACAACCTCA TCGCCGGCGA AATCCCAAGC TCCATCACCT CGCTCGCGTC GCTGAAGCAC CTCGACCTCA
CCAACAACCA GCTCACCGGC GGGATCCCGG ACGACGTGGG CGACCTCACC ATGCTCAGCC GCGCGCTGCT CGGCCGGAAC
AAGCTCACCG GCGCCATCCC AACGTCGGTC GGCTCCCTGA CCCGGCTCGC CGACCTCGAC CTCGCCGAGA ACGGCCTCAC
CGGCGGGATC CCGGACAGCC TGGGCGGCGC CCACGTGCTC ACCTCCCTGT ACCTCGGCGG CAACCGGGTC TCCGGCCGGA
TCCCGGCGAG CCTGCTGCAG AACAAGGGGC TGGGCATCCT GAACCTGAGC CGGAACGCCG TCGAGGGCGC CATCCCCGAC
GTGTTCACCG CCGAGTCCTA CTTCATGGTG CTCGACCTGT CCCGGAACAG GCTCACCGGC GCCGTGCCGA GGTCGCTGTC
GGCGGCAGCG TACGTCGGCC ACCTCGACCT CAGCCACAAC CGGCTGTGCG GCTCCATCCC CGCCGGCCCG CCGTTCGACC
ACCTCGACGC CGCCTCCTTC GCCAGCAACA GCTGCCTCTG CGGCGGCCCG CTCGGCAAGT GCACGTGACG TGCCCCAACC
AGAGCCGTCC GATCGATCGG GAGAGCCTGA TCGAACGTGT GGTGTGCGAT GTACCGTGTA CGATGCAACG AACTTACGTG
TTCGTATATA TGGTTAATTA GTTGCTGCTT AAGTATTAAC TCACTTGGGC TATAGTTTTG GGCTTGGGTA CATATAGAAC
AAGATGAGAA TTTGTGCCTA GTGTGTGTGT GTGTGAGAGA AAGAGGAAGT GGTTAAGGAA AAGAAGAATG TTTTCTCTTT
CCTGCCTTTC TCTTCTTTAT ACTTTTAACC TTTTTTGCTA GTGATTTACT TGATAGTTCT ACTTTAAAGT TTGTATTGTA
CAAGTGACAA AAGCATAAGA AATGCTAAAG ATCTTGTATG AG

Locus: Os08g0505900

Loading...

Locus: Os08g0505900

Loading...