Os08t0509600-01

Locus

Os08g0509600

Description

Squamosa promter-binding-like transcription activator, Regulation of branching in panicles and vegetative shoots, Semidominant regulator of plant architecture

RAP-DB Gene Symbol Synonym(s)

WFP, OsSPL14, SPL14, IPA1, WFP/IPA1

RAP-DB Gene Name Synonym(s)

WEALTHY FARMER'S PANICLE, IDEAL PLANT ARCHITECTURE 1, Ideal Plant Architecture 1, Ideal Plant Architecture1, Squamosa promoter-binding-like protein 14, SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 14, Squamosa promoter binding protein like-14, IDEAL PLANT ARCHITECTURE1

CGSNL Gene Symbol

WFP

CGSNL Gene Name

WEALTHY FARMER'S PANICLE

Oryzabase Gene Symbol Synonym(s)

OsSPL14, SPL14, IPA1, WFP/IPA1, OsSPL14/WFP/IPA1, OsIPA1, IPA1/OsSPL14

Oryzabase Gene Name Synonym(s)

IDEAL PLANT ARCHITECTURE 1, Ideal Plant Architecture 1, Ideal Plant Architecture1, Squamosa promoter-binding-like protein 14, SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 14, Squamosa promoter binding protein like-14, IDEAL PLANT ARCHITECTURE1

Transcript Evidence

AK107191

Protein Evidence

Q7EXZ2

B7F043

Literature

PMID: 16861571

PMID: 20495564

PMID: 20495565

PMID: 24170127

Note

Manual Curation

March 13, 2014

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

002-125-A04 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0509600-01)

Others

Oryzabase (8877)

KEGG (Os08t0509600-01)

Transcript

1624 bp

>Os08t0509600-01 Squamosa promter-binding-like transcription activator, Regulation of branching in panicles and vegetative shoots, Semidominant regulator of plant architecture
TTCCGTCTCTTTCCTCTCTCTTCTCTCTCCCCCTCTCCTGGAGGAGAGAGAGGAGAAGAG
GAGGGGGGGCCGCGCCAAGAGCCACGCGCGCTACAGTCTCCTTCCCACCCGCGACCGCGA
GCAATGGAGATGGCCAGTGGAGGAGGCGCCGCCGCCGCCGCCGGCGGCGGAGTAGGCGGC
AGCGGCGGCGGTGGTGGTGGAGGGGACGAGCACCGCCAGCTGCACGGTCTCAAGTTCGGC
AAGAAGATCTACTTCGAGGACGCCGCCGCGGCAGCAGGCGGCGGCGGCACTGGCAGTGGC
AGTGGCAGCGCGAGCGCCGCGCCGCCGTCCTCGTCTTCCAAGGCGGCGGGTGGTGGACGC
GGCGGAGGGGGCAAGAACAAGGGGAAGGGCGTGGCCGCGGCGGCGCCACCGCCGCCGCCG
CCGCCGCCGCGGTGCCAGGTGGAGGGGTGCGGCGCGGATCTGAGCGGGATCAAGAACTAC
TACTGCCGCCACAAGGTGTGCTTCATGCATTCCAAGGCTCCCCGCGTCGTCGTCGCCGGC
CTCGAGCAGCGCTTCTGCCAGCAGTGCAGCAGGTTCCACCTGCTGCCTGAATTTGACCAA
GGAAAACGCAGCTGCCGCAGACGCCTTGCAGGTCATAATGAGCGCCGGAGGAGGCCGCAA
ACCCCTTTGGCATCACGCTACGGTCGACTAGCTGCATCTGTTGGTGAGCATCGCAGGTTC
AGAAGCTTTACGTTGGATTTCTCCTACCCAAGGGTTCCAAGCAGCGTAAGGAATGCATGG
CCAGCAATTCAACCAGGCGATCGGATCTCCGGTGGTATCCAGTGGCACAGGAACGTAGCT
CCTCATGGTCACTCTAGTGCAGTGGCGGGATATGGTGCCAACACATACAGCGGCCAAGGT
AGCTCTTCTTCAGGGCCACCGGTGTTCGCTGGCCCAAATCTCCCTCCAGGTGGATGTCTC
GCAGGGGTCGGTGCCGCCACCGACTCGAGCTGTGCTCTCTCTCTTCTGTCAACCCAGCCA
TGGGATACTACTACCCACAGTGCCGCTGCCAGCCACAACCAGGCTGCAGCCATGTCCACT
ACCACCAGCTTTGATGGCAATCCTGTGGCACCCTCCGCCATGGCGGGTAGCTACATGGCA
CCAAGCCCCTGGACAGGTTCTCGGGGCCATGAGGGTGGTGGTCGGAGCGTGGCGCACCAG
CTACCACATGAAGTCTCACTTGATGAGGTGCACCCTGGTCCTAGCCATCATGCCCACTTC
TCCGGTGAGCTTGAGCTTGCTCTGCAGGGGAACGGTCCAGCCCCAGCACCACGCATCGAT
CCTGGGTCCGGCAGCACCTTCGACCAAACCAGCAACACGATGGATTGGTCTCTGTAGAGG
CTGTTCCAGCTGCCATCGATCTGTCGTCCCGCAAGGCGAGTCATGGAACTGAAGAACCTC
ATGCTGCCTGCCCTTATTTTGTGTTCAAATTTTCCTTTCCAGTATGGAAAGGAAATTCTA
AGGTGACTGGCGATTAATCTCCCTGTGATGAATAATAATGCGCGCCCTTGAACTCAATTA
ATTGCTGTGCCGCATCCATCTATGTAACTCTCCATGAATTTTTAAGTATCAGTGTTAATG
CTGT

CDS

1254 bp

>Os08t0509600-01 Squamosa promter-binding-like transcription activator, Regulation of branching in panicles and vegetative shoots, Semidominant regulator of plant architecture
ATGGAGATGGCCAGTGGAGGAGGCGCCGCCGCCGCCGCCGGCGGCGGAGTAGGCGGCAGC
GGCGGCGGTGGTGGTGGAGGGGACGAGCACCGCCAGCTGCACGGTCTCAAGTTCGGCAAG
AAGATCTACTTCGAGGACGCCGCCGCGGCAGCAGGCGGCGGCGGCACTGGCAGTGGCAGT
GGCAGCGCGAGCGCCGCGCCGCCGTCCTCGTCTTCCAAGGCGGCGGGTGGTGGACGCGGC
GGAGGGGGCAAGAACAAGGGGAAGGGCGTGGCCGCGGCGGCGCCACCGCCGCCGCCGCCG
CCGCCGCGGTGCCAGGTGGAGGGGTGCGGCGCGGATCTGAGCGGGATCAAGAACTACTAC
TGCCGCCACAAGGTGTGCTTCATGCATTCCAAGGCTCCCCGCGTCGTCGTCGCCGGCCTC
GAGCAGCGCTTCTGCCAGCAGTGCAGCAGGTTCCACCTGCTGCCTGAATTTGACCAAGGA
AAACGCAGCTGCCGCAGACGCCTTGCAGGTCATAATGAGCGCCGGAGGAGGCCGCAAACC
CCTTTGGCATCACGCTACGGTCGACTAGCTGCATCTGTTGGTGAGCATCGCAGGTTCAGA
AGCTTTACGTTGGATTTCTCCTACCCAAGGGTTCCAAGCAGCGTAAGGAATGCATGGCCA
GCAATTCAACCAGGCGATCGGATCTCCGGTGGTATCCAGTGGCACAGGAACGTAGCTCCT
CATGGTCACTCTAGTGCAGTGGCGGGATATGGTGCCAACACATACAGCGGCCAAGGTAGC
TCTTCTTCAGGGCCACCGGTGTTCGCTGGCCCAAATCTCCCTCCAGGTGGATGTCTCGCA
GGGGTCGGTGCCGCCACCGACTCGAGCTGTGCTCTCTCTCTTCTGTCAACCCAGCCATGG
GATACTACTACCCACAGTGCCGCTGCCAGCCACAACCAGGCTGCAGCCATGTCCACTACC
ACCAGCTTTGATGGCAATCCTGTGGCACCCTCCGCCATGGCGGGTAGCTACATGGCACCA
AGCCCCTGGACAGGTTCTCGGGGCCATGAGGGTGGTGGTCGGAGCGTGGCGCACCAGCTA
CCACATGAAGTCTCACTTGATGAGGTGCACCCTGGTCCTAGCCATCATGCCCACTTCTCC
GGTGAGCTTGAGCTTGCTCTGCAGGGGAACGGTCCAGCCCCAGCACCACGCATCGATCCT
GGGTCCGGCAGCACCTTCGACCAAACCAGCAACACGATGGATTGGTCTCTGTAG

Protein

418 aa

>Os08t0509600-01 Squamosa promter-binding-like transcription activator, Regulation of branching in panicles and vegetative shoots, Semidominant regulator of plant architecture
MEMASGGGAAAAAGGGVGGSGGGGGGGDEHRQLHGLKFGKKIYFEDAAAAAGGGGTGSGS
GSASAAPPSSSSKAAGGGRGGGGKNKGKGVAAAAPPPPPPPPRCQVEGCGADLSGIKNYY
CRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRSCRRRLAGHNERRRRPQT
PLASRYGRLAASVGEHRRFRSFTLDFSYPRVPSSVRNAWPAIQPGDRISGGIQWHRNVAP
HGHSSAVAGYGANTYSGQGSSSSGPPVFAGPNLPPGGCLAGVGAATDSSCALSLLSTQPW
DTTTHSAAASHNQAAAMSTTTSFDGNPVAPSAMAGSYMAPSPWTGSRGHEGGGRSVAHQL
PHEVSLDEVHPGPSHHAHFSGELELALQGNGPAPAPRIDPGSGSTFDQTSNTMDWSL*

5'UTR

chr08:25278574..25278696 (- strand) : 123 bp

CDS

chr08:25278125..25278573 (- strand) : 449 bp

chr08:25275561..25275694 (- strand) : 134 bp

chr08:25274788..25275458 (- strand) : 671 bp

3'UTR

chr08:25274541..25274787 (- strand) : 247 bp

FASTA

>Os08t0509600-01 class=Sequence position=chr08:25274541..25278696 (- strand)
TTCCGTCTCT TTCCTCTCTC TTCTCTCTCC CCCTCTCCTG GAGGAGAGAG AGGAGAAGAG GAGGGGGGGC CGCGCCAAGA
GCCACGCGCG CTACAGTCTC CTTCCCACCC GCGACCGCGA GCAATGGAGA TGGCCAGTGG AGGAGGCGCC GCCGCCGCCG
CCGGCGGCGG AGTAGGCGGC AGCGGCGGCG GTGGTGGTGG AGGGGACGAG CACCGCCAGC TGCACGGTCT CAAGTTCGGC
AAGAAGATCT ACTTCGAGGA CGCCGCCGCG GCAGCAGGCG GCGGCGGCAC TGGCAGTGGC AGTGGCAGCG CGAGCGCCGC
GCCGCCGTCC TCGTCTTCCA AGGCGGCGGG TGGTGGACGC GGCGGAGGGG GCAAGAACAA GGGGAAGGGC GTGGCCGCGG
CGGCGCCACC GCCGCCGCCG CCGCCGCCGC GGTGCCAGGT GGAGGGGTGC GGCGCGGATC TGAGCGGGAT CAAGAACTAC
TACTGCCGCC ACAAGGTGTG CTTCATGCAT TCCAAGGCTC CCCGCGTCGT CGTCGCCGGC CTCGAGCAGC GCTTCTGCCA
GCAGTGCAGC AGGTCACTCT CTCACTCACC TCGCCATTGC TGATGTCACC ACTGCTTTTG CTTTGCTTTG CTTGCTCTCC
CTCCTCTTTC ACCTATCTCT CTTGTTTATT TGCTTCTTGT TCTTGTTTAG TGCTAGTACA TGTGTTGTTA TTGTTGTGCC
GTTTTGTCTT TTGGGTTATT GTGTTGTTGT TACTACTCGT TTTACTATAG GTTTTTAAGG TTTATGAGCA CGGCCACCAC
ATTAGATGCA CTGTCAAGTG GTGTGTGTGG GACCTTTCCT GCTAAAACAA GCTGATTTCA ACTCTCTGAA ACTTCCTGCA
TTTCATCTAT TTTTATCTTT GATTGTGTTG GGAGTACTAC ACTAGTAGTG TTAATATTTT GACTGGTGCT TATGAGATTT
TTAAGTTGGT AGGTTGATGA GGAAAATACT CCTTTATATG GTTGAGTGAT GTGACTTGCC TGTCTGCCTG CCTGCCTGCC
GCTTTGCATA AGATTCCTCT GTGTTAGTAA GAGCCACTGT TTATTTGTAC TGGTGCTTAC TCTACTTAGT TAATTAGCCA
TTAGCTATAA AATTCCGTTG ATGTTGCAAG CTTAGCAATG GCCACGGTAA GAATGGGAGA GAGAAGTTGG CTAAAGCTGT
TGCTTTGTAG TTTGTACTAT ATATGTGTCT TTGTGTTGCA AGATATGCAA CTCCTACTAT GCTGTGACTT GAGCTCAAGG
TTTTCAGTTA TCTATAGATC CTTACTACTA CTGAGCATAC TACCACTTCT GTATGGTAGC ATATGGTAGC ATAGTCCAAG
TTCCAACGCC TCGCCAGTTG TTCATAATCT ATACTACCAC TTCTGTGCAT TTGTTACTTT TATTTAATAG TTTGTCTCAT
TAGCTGACAA GCATATGCCT GTTTTGATAT CTGCCCCTCT TGTAATAGTC TATGGATAGC TTGGACTGTT TGATGCTTTA
ATTTTTTACT AGCAACACTT Agggcccctt tgaaatggag gattagcaaa ggaattttgg aggattcatt ttcctaagga
ttttttccta tagagccctt tgattcatag aaagaggata ggaaaacttc cgtaggattg cattcctatg atcaattcca
taggaaaata agcaagaggt tagacctctt gtgaaacttt cctttgttga gtgtatcttg tggtataatc aaagggctct
tctctccatt tcatgtgttt tcaattcctg taggATTGGA AAAACATACA ACTTCAATTc ctacgttttt cctattccta
tgtttttcct atcctgcgtt tcaaaggggc ccTTAAGGAT GAAGGGAAGT AAGAGAAACA TACTAGAGAA TATGTAGTAG
TATTTCTACA TTCCATATTT GTAGCACTAG CCCACAAATA TCTTTGCCTT GTACTTACTT CATACCAGTT CCCCCCTTTT
CAGAGCAAAC CAACAATTTC TGTTGCCTTA TATATCTAGT GTCTTCGTAC TAATATATCT GTTCCAAAAT GTACCTGTCC
AAATTCATAG CTAGAAATAG CTTTATTTAG GACGGAAGTA ATAACTGTTG TTAGAGACTT GGTTCAGACT TTTGGTTATG
TTGAGGCTAC TATCATTTCC TTTACGGGCC AAATTACTAC AAATGAGAAT TCATAAAAAT GTCAAGATTT TATGATTGTT
GTAGCTTTAT TTAGGACGGA GGTAGTAATT GTTGTTAGAG ACTTGGTTCA GACTTTTGGT TACGTTGAAG CTACTATCAT
TTCCTTTATG GTCAAATTAC TAACAATGAG TATTCATAAA AATGTCAAGA TTTTATAATT GAGCTGTGCC AGTGCTAAGT
GTGTCACTAT CTGATGCCAT AATGCATCAT TATAAAAGCC AGATGGACCA TTAGCTTTTA TGTGTAGGAC ACCTGCCGTC
CAATTAGATG GATAACCATC TAGTGTTTGT GTACTGTTAT TTTAAGCCCG ACATCTCACA ACTCCATGAA TGATTACAGT
CTTCCTTTCA CATGGTGTCC TTTTGTTGTG TTAGGAATAG CATTTTTTAT TTATGGGTGT AATTATGAAA GGCACTAGGA
GAGTTGCTGC TTTATCTTGA TGGGATTTGT AGTAATACCA TCTTTAGGAT GACAAGAAAT CTTGTTCTGA GTTAGCATGG
GCTGCCTTTT GACCTGAGCT ACGGTTTGCT ATGTTTGGCT TGCATCATGC AGATCTATTA GGATAATAAG CATATAAAAG
TTGCTTGCAT TGTGCATTGC TTGTTTTACC TTGATTCATG TAGGAGTAAT TTGCTCGCCA TGCCTCGTTT TGCTTTCTGA
GTCAACAGCC AAATTTAGAT GATGTACCTT CTGTTGCTTC AAAAACTCAG TCACTGCACA GCAGCAGTGG ATAGGATTCA
GAATCAATCT ATCCATGATT CTCTGTTCAC ATAATATGAC AGGTTCCACC TGCTGCCTGA ATTTGACCAA GGAAAACGCA
GCTGCCGCAG ACGCCTTGCA GGTCATAATG AGCGCCGGAG GAGGCCGCAA ACCCCTTTGG CATCACGCTA CGGTCGACTA
GCTGCATCTG TTGGTGGTAT CATCAGAGGC TCTTGTTTTC TTTGCATCTT GTGTGTTTGT TGGTAACTAC TGGTTGCATT
CGCTGATGTG TTGTTTGTTG CGATTCTTGA TCCAGAAGAG CATCGCAGGT TCAGAAGCTT TACGTTGGAT TTCTCCTACC
CAAGGGTTCC AAGCAGCGTA AGGAATGCAT GGCCAGCAAT TCAACCAGGC GATCGGATCT CCGGTGGTAT CCAGTGGCAC
AGGAACGTAG CTCCTCATGG TCACTCTAGT GCAGTGGCGG GATATGGTGC CAACACATAC AGCGGCCAAG GTAGCTCTTC
TTCAGGGCCA CCGGTGTTCG CTGGCCCAAA TCTCCCTCCA GGTGGATGTC TCGCAGGGGT CGGTGCCGCC ACCGACTCGA
GCTGTGCTCT CTCTCTTCTG TCAACCCAGC CATGGGATAC TACTACCCAC AGTGCCGCTG CCAGCCACAA CCAGGCTGCA
GCCATGTCCA CTACCACCAG CTTTGATGGC AATCCTGTGG CACCCTCCGC CATGGCGGGT AGCTACATGG CACCAAGCCC
CTGGACAGGT TCTCGGGGCC ATGAGGGTGG TGGTCGGAGC GTGGCGCACC AGCTACCACA TGAAGTCTCA CTTGATGAGG
TGCACCCTGG TCCTAGCCAT CATGCCCACT TCTCCGGTGA GCTTGAGCTT GCTCTGCAGG GGAACGGTCC AGCCCCAGCA
CCACGCATCG ATCCTGGGTC CGGCAGCACC TTCGACCAAA CCAGCAACAC GATGGATTGG TCTCTGTAGA GGCTGTTCCA
GCTGCCATCG ATCTGTCGTC CCGCAAGGCG AGTCATGGAA CTGAAGAACC TCATGCTGCC TGCCCTTATT TTGTGTTCAA
ATTTTCCTTT CCAGTATGGA AAGGAAATTC TAAGGTGACT GGCGATTAAT CTCCCTGTGA TGAATAATAA TGCGCGCCCT
TGAACTCAAT TAATTGCTGT GCCGCATCCA TCTATGTAAC TCTCCATGAA TTTTTAAGTA TCAGTGTTAA TGCTGT