Os08t0510300-01

Locus

Os08g0510300

Description

High-affinity potassium transporter 26, Maintenance of pollen development and fertility, Tolerance of pollen grains to the environmental stress of desiccation

RAP-DB Gene Symbol Synonym(s)

OsHAK26

RAP-DB Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 26

CGSNL Gene Symbol

HAK26

CGSNL Gene Name

HIGH-AFFINITY POTASSIUM(K+) TRANSPORTER 26

Oryzabase Gene Symbol Synonym(s)

OsHAK26

Oryzabase Gene Name Synonym(s)

High-affinity Potassium(K+) Transporter 26, Potassium transporter 26

Transcript Evidence

AK072472

Protein Evidence

Q84YJ9

Literature

PMID: 35536598

Note

Manual Curation

May 12, 2022

Gene Ontology (GO)

Biological Process: potassium ion transmembrane transport (GO:0071805)

Molecular Function: potassium ion transmembrane transporter activity (GO:0015079)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Potassium transporter (IPR003855)

Experimentally confirmed subcellular location

Golgi apparatus (GO:0005794)

Full-length cDNA

J023119J10 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0510300-01)

RiceXPro (AK072472)

Others

Oryzabase (8680)

KEGG (Os08t0510300-01)

Transcript

2729 bp

>Os08t0510300-01 High-affinity potassium transporter 26, Maintenance of pollen development and fertility, Tolerance of pollen grains to the environmental stress of desiccation
TTGCTATAGCTAGGTCAAATCGATCGATCTCGATCGATCGGGTGGTCGATCCGATCAGCA
GCCATGGAGTACCACCACCGGCCGCATTCGCCGCCGCCGTCGGACGACGACGTCGTCGTC
ATCCAGATGAACGCCGCCGCCATCGCCGCCGTCGACGAGTGGAGCTCCACCAACGAGGTG
GACGACGCCGCCGCCGGCAAGGGCGGCGGCCTCACCCGCCGGACCTTCAGCCAGGCCTAC
AAGATGAAGCACCGGACGCCACTGGAGTTCACGTGGAGGCAGGTGGCGTTGCTGAGCTTC
CAGTCGCTGGGGGTGGTGTACGGAGACCTGGGGACGTCGCCGCTGTACGTGTTCTCGTCG
ATCTCGCTGGACGACCCCGGCGAGGCGGACTTCGTCGGAATCCTCAGCATCATCCTCTGG
ACCTTCACCATGATCTGCCTCGTCAAGTACGTCTTCATCGTCCTCAAAGCTGACGACCAT
GGAGAAGGTGGCACTTTTGCGCTGTACTCGCTTCTGCGTCAGCATGTGAATTTCAAGGGA
AACATGCCAGTGCCAGTCACACACTTGGCATCTGACATCAACCTCAAGTTCCACAGTAAG
AAGAGGATTCTGACGTCCAAGCTCCTCAAGTTCTTGGAACAAAGCACAAAATGGCAGGCA
GTCATTACCTACATCGTGCTTGCTGGGACTTGCATGGTGCTAGGAGATGGTGCCCTCACT
CCAGCCATCTCAGTTCTGTCAGCTGTTCAAGGAATCCAATCAAGATCTTCAAGCATAACA
CAAGCTCATGTTGTGTTGCTATCTGTGATTATCTTGTTCATACTATTCTTCTTCCAAAAA
CATGGCACAAGCAAAGTCAGCTTCACTTTTTCTCCCATTATGATCTTGTGGTTTACATTC
GTTGCATTCATTGGATTGTACAATATCATCAAGCACTATCCACCAATTCTGAAAGCTGTG
TCGCCCCATTACATAATCATATACTTCATAAGGAACAAAAGAGCGGCCTGGGAGACACTT
GGAGCAATTGTTCTATGCATAACAGGTGCTGAAGCTATGTTTGCTGACTTGGGTCATTTC
AACAAATCATCAATCCAGATGGCATTTTCAGTCATAGTTTATCCATCAATGATCCTTGCG
TATGCCGGGCAGGCAGCATTTTTGGTCAAGAACCCTTCAAAGCTCAGCACGACGTTCTAC
AGTAGTACTCCAGAGCCACTATTTTGGCCCATGTTTATCATAGCAACTTTGGCTGCTATT
GTTGCGAGCCAAGCATTGATATCAGCCAGCTTCTCCATCATTCGACAATCAATTGCTTTG
GGTTGTTTTCCAAGAGTTACCATGAAGCATACCTCAGGCAAACAtgaaggccaagtatac
tctccagagatcaattactttttgatggttgcgtgcatcttaattactgttgggttTAAG
GGTGGACCAGAGATAGGGCAAGCCTTTGGCGTGGCAGTGATATTTGTTATGCTTTTTACA
ACAAACCTGATGACAGTGGTCATGCTTATAATATGGGAAAGTAACATTGCACTTGCCAGT
CTATTTTTTGTTTTTTTCTTTTCCATCGAAGGCATTTACATGACCTCGTTAATGAACAAG
ATTCTACAAGGTGGCTGGGTTCCATTTGCCATTACTGCATTTTTCCTGATAATTACACTA
TCTTGGACTTATGGAAGAAGTAAGAAGGGTGAATATGAACTTGCCAATGTGATGGAAAGG
GAGGAATTTATTAAGACAGTAACAACGAGAAGCCGAGTACCTGGAGTATGCATCTTCTGC
ACGGATATGATGAATGGCATCCCGCCGATTGTGCGCCATTATGTTCAGCATGTGGCTTCC
CTCCGTGAACTGATGGTGTTTGTCACTATCAGGGTTCTTCCGGTGAGAACTGTCCTTCCT
GAAGAGCGCTTCATCATAGACAAGCTAGAGCCAGTGGGTGTCTACAGGTGCATAGTCCAA
TATGGCTATATGGACAACCACAATATGGAGGGTGACGATTACGTTGCATCAGTTATTGCA
TCCCTCAAGGAAATAGCTGAGAATGATGATGAGATTCTGGTGTTGGATTCAGCTTTGATA
AATGGATCAACCTTTGTTCTTGGCAGGACTATCATAAAGATGGGAACTAGGCACAACTGT
TTGAAGCGCTTTTTTATTAATAACCTTTACAGGTTCTTGCAAAAGAACTTCAGATCCAAC
ATGTCCAGTCTAAAGATAAATCCTGGTAAAACCTTGCAAGTTGGAATGCTATATGAGATT
TGAAGAAGGTGACCAATTGTGGATGCATAAATGTGAAGTGTTAGCTAGAATGCTAGATTG
CTGAAATTGGCAGACAGACAAGTTTTTCTTGATTATAAATGTCACAGAATTGTTTGGATG
TGACCCATATTTTCTTAGCATGCAAACCATCTGCAATAATTGTCCTGTGAGTAGATGACC
AAGTTATATACACTTTTGGGATAATTTTATTAGTGGGATGCAATTCTCTTTTTTTCTCCC
CTAATATTTCACACTCTAAACTGCACCAACTTGTAGGCTGGTTAGTGAATGGTAAAGAAA
AAATGTTGCACAGTGTGCAATTTATGTACACATACCATTCTCATTTATTTTCCAGTTGTA
TTTTGATAAGATGGTTATCTAAATCATATTCTTTGGTGAAAGTGTAAACCTCCTTGTAAA
ACAATATAGATCTTAATGTTGCAATGCTC

CDS

2220 bp

>Os08t0510300-01 High-affinity potassium transporter 26, Maintenance of pollen development and fertility, Tolerance of pollen grains to the environmental stress of desiccation
ATGGAGTACCACCACCGGCCGCATTCGCCGCCGCCGTCGGACGACGACGTCGTCGTCATC
CAGATGAACGCCGCCGCCATCGCCGCCGTCGACGAGTGGAGCTCCACCAACGAGGTGGAC
GACGCCGCCGCCGGCAAGGGCGGCGGCCTCACCCGCCGGACCTTCAGCCAGGCCTACAAG
ATGAAGCACCGGACGCCACTGGAGTTCACGTGGAGGCAGGTGGCGTTGCTGAGCTTCCAG
TCGCTGGGGGTGGTGTACGGAGACCTGGGGACGTCGCCGCTGTACGTGTTCTCGTCGATC
TCGCTGGACGACCCCGGCGAGGCGGACTTCGTCGGAATCCTCAGCATCATCCTCTGGACC
TTCACCATGATCTGCCTCGTCAAGTACGTCTTCATCGTCCTCAAAGCTGACGACCATGGA
GAAGGTGGCACTTTTGCGCTGTACTCGCTTCTGCGTCAGCATGTGAATTTCAAGGGAAAC
ATGCCAGTGCCAGTCACACACTTGGCATCTGACATCAACCTCAAGTTCCACAGTAAGAAG
AGGATTCTGACGTCCAAGCTCCTCAAGTTCTTGGAACAAAGCACAAAATGGCAGGCAGTC
ATTACCTACATCGTGCTTGCTGGGACTTGCATGGTGCTAGGAGATGGTGCCCTCACTCCA
GCCATCTCAGTTCTGTCAGCTGTTCAAGGAATCCAATCAAGATCTTCAAGCATAACACAA
GCTCATGTTGTGTTGCTATCTGTGATTATCTTGTTCATACTATTCTTCTTCCAAAAACAT
GGCACAAGCAAAGTCAGCTTCACTTTTTCTCCCATTATGATCTTGTGGTTTACATTCGTT
GCATTCATTGGATTGTACAATATCATCAAGCACTATCCACCAATTCTGAAAGCTGTGTCG
CCCCATTACATAATCATATACTTCATAAGGAACAAAAGAGCGGCCTGGGAGACACTTGGA
GCAATTGTTCTATGCATAACAGGTGCTGAAGCTATGTTTGCTGACTTGGGTCATTTCAAC
AAATCATCAATCCAGATGGCATTTTCAGTCATAGTTTATCCATCAATGATCCTTGCGTAT
GCCGGGCAGGCAGCATTTTTGGTCAAGAACCCTTCAAAGCTCAGCACGACGTTCTACAGT
AGTACTCCAGAGCCACTATTTTGGCCCATGTTTATCATAGCAACTTTGGCTGCTATTGTT
GCGAGCCAAGCATTGATATCAGCCAGCTTCTCCATCATTCGACAATCAATTGCTTTGGGT
TGTTTTCCAAGAGTTACCATGAAGCATACCTCAGGCAAACAtgaaggccaagtatactct
ccagagatcaattactttttgatggttgcgtgcatcttaattactgttgggttTAAGGGT
GGACCAGAGATAGGGCAAGCCTTTGGCGTGGCAGTGATATTTGTTATGCTTTTTACAACA
AACCTGATGACAGTGGTCATGCTTATAATATGGGAAAGTAACATTGCACTTGCCAGTCTA
TTTTTTGTTTTTTTCTTTTCCATCGAAGGCATTTACATGACCTCGTTAATGAACAAGATT
CTACAAGGTGGCTGGGTTCCATTTGCCATTACTGCATTTTTCCTGATAATTACACTATCT
TGGACTTATGGAAGAAGTAAGAAGGGTGAATATGAACTTGCCAATGTGATGGAAAGGGAG
GAATTTATTAAGACAGTAACAACGAGAAGCCGAGTACCTGGAGTATGCATCTTCTGCACG
GATATGATGAATGGCATCCCGCCGATTGTGCGCCATTATGTTCAGCATGTGGCTTCCCTC
CGTGAACTGATGGTGTTTGTCACTATCAGGGTTCTTCCGGTGAGAACTGTCCTTCCTGAA
GAGCGCTTCATCATAGACAAGCTAGAGCCAGTGGGTGTCTACAGGTGCATAGTCCAATAT
GGCTATATGGACAACCACAATATGGAGGGTGACGATTACGTTGCATCAGTTATTGCATCC
CTCAAGGAAATAGCTGAGAATGATGATGAGATTCTGGTGTTGGATTCAGCTTTGATAAAT
GGATCAACCTTTGTTCTTGGCAGGACTATCATAAAGATGGGAACTAGGCACAACTGTTTG
AAGCGCTTTTTTATTAATAACCTTTACAGGTTCTTGCAAAAGAACTTCAGATCCAACATG
TCCAGTCTAAAGATAAATCCTGGTAAAACCTTGCAAGTTGGAATGCTATATGAGATTTGA

Protein

739 aa

>Os08t0510300-01 High-affinity potassium transporter 26, Maintenance of pollen development and fertility, Tolerance of pollen grains to the environmental stress of desiccation
MEYHHRPHSPPPSDDDVVVIQMNAAAIAAVDEWSSTNEVDDAAAGKGGGLTRRTFSQAYK
MKHRTPLEFTWRQVALLSFQSLGVVYGDLGTSPLYVFSSISLDDPGEADFVGILSIILWT
FTMICLVKYVFIVLKADDHGEGGTFALYSLLRQHVNFKGNMPVPVTHLASDINLKFHSKK
RILTSKLLKFLEQSTKWQAVITYIVLAGTCMVLGDGALTPAISVLSAVQGIQSRSSSITQ
AHVVLLSVIILFILFFFQKHGTSKVSFTFSPIMILWFTFVAFIGLYNIIKHYPPILKAVS
PHYIIIYFIRNKRAAWETLGAIVLCITGAEAMFADLGHFNKSSIQMAFSVIVYPSMILAY
AGQAAFLVKNPSKLSTTFYSSTPEPLFWPMFIIATLAAIVASQALISASFSIIRQSIALG
CFPRVTMKHTSGKHEGQVYSPEINYFLMVACILITVGFKGGPEIGQAFGVAVIFVMLFTT
NLMTVVMLIIWESNIALASLFFVFFFSIEGIYMTSLMNKILQGGWVPFAITAFFLIITLS
WTYGRSKKGEYELANVMEREEFIKTVTTRSRVPGVCIFCTDMMNGIPPIVRHYVQHVASL
RELMVFVTIRVLPVRTVLPEERFIIDKLEPVGVYRCIVQYGYMDNHNMEGDDYVASVIAS
LKEIAENDDEILVLDSALINGSTFVLGRTIIKMGTRHNCLKRFFINNLYRFLQKNFRSNM
SSLKINPGKTLQVGMLYEI*

5'UTR

chr08:25313546..25313608 (+ strand) : 63 bp

CDS

chr08:25313609..25313809 (+ strand) : 201 bp

chr08:25313951..25314173 (+ strand) : 223 bp

chr08:25315172..25315417 (+ strand) : 246 bp

chr08:25315878..25315928 (+ strand) : 51 bp

chr08:25316046..25316306 (+ strand) : 261 bp

chr08:25316401..25316453 (+ strand) : 53 bp

chr08:25316534..25316903 (+ strand) : 370 bp

chr08:25317310..25318124 (+ strand) : 815 bp

3'UTR

chr08:25318125..25318570 (+ strand) : 446 bp

FASTA

>Os08t0510300-01 class=Sequence position=chr08:25313546..25318570 (+ strand)
TTGCTATAGC TAGGTCAAAT CGATCGATCT CGATCGATCG GGTGGTCGAT CCGATCAGCA GCCATGGAGT ACCACCACCG
GCCGCATTCG CCGCCGCCGT CGGACGACGA CGTCGTCGTC ATCCAGATGA ACGCCGCCGC CATCGCCGCC GTCGACGAGT
GGAGCTCCAC CAACGAGGTG GACGACGCCG CCGCCGGCAA GGGCGGCGGC CTCACCCGCC GGACCTTCAG CCAGGCCTAC
AAGATGAAGC ACCGGACGCC ACTGGTAAAT ACGCAGTCCA TTTCCGCTGA TTTCATGCGC CATTCTTGGT GTTCTTCTCC
TCCTTTTGTC GATCGATTCG ATCTGCGGTT TGTGGTTGAT GTGATCGATC GATCTGTGGA TTGGGATTTG GGGAAAAAAT
TGCAGGAGTT CACGTGGAGG CAGGTGGCGT TGCTGAGCTT CCAGTCGCTG GGGGTGGTGT ACGGAGACCT GGGGACGTCG
CCGCTGTACG TGTTCTCGTC GATCTCGCTG GACGACCCCG GCGAGGCGGA CTTCGTCGGA ATCCTCAGCA TCATCCTCTG
GACCTTCACC ATGATCTGCC TCGTCAAGTA CGTCTTCATC GTCCTCAAAG CTGACGACCA TGGAGAAGGT ATATATCTGC
ACTATACAct ccgtactcgt aaaggaagtt gttttggact gtgacacggt ctccaaaaca caactttgac ttcttttttc
tataaaaata tttattgaaa agtgatatat gtataccttt atgaaagtat ttttcaagac aaatctactc atataatttt
tacattttca aactcaacga cttgagtgtt attcatgatt tatattacca aggtttgact taaacattgc cctaaacgat
tttctttatg agtatggtgg gagTATATCA CTATATATAG ATATATAATT CGGATCTATT TGCCAATCAC TTCTTTTTTA
CTACTAGATC AACGCTCAAC AATTCGCGTG TCAATCCTTT TATTGTCATG GAATAACCTT TTGTTGGAAG AAAACTGTAT
TTTGGTGTAC CTTGATAAGT ATAGAAGTGC Atccgtccca aaatacagaa atctaggatt gaatgagaca tatcccagaa
ctatcaatct aaacatacat atgtctatat taataatcat aagatatgtc tcatctggtt ctagattttt atattttggg
acgaaaagag taGTAGATGA AAAACAAGAA AATCACAAGT TACACTAAAT TTTAGATTGT GCAGGTTTAG TGTGTTACAC
GTTTAATATA CTAATAGAGC CGACCGACAA ATAGCAAAAT TGAAGTAAAT CATTTAGTAT TAATTTTCCT CAATAATTTT
TACAAAAACA TCATGCCATT TTAAACATAC GTGCGGTGAA ACTTTCGAAA CATATAATAT CAATATCTCT CTTTTTTTTC
AAAATTATGA CTGGATACAT GAAAATCATA CAGATAGATT GATCCATCTA TAATAATCTC CCAATTTTAT AAGGCTTAGA
TTGATCATCT ATAATCTCCT AATTTTATAG GGCTTCTCGA GTGCATGTTC TTTCATTCAA TTCTCCTAAT TTTGTGATAT
ATTTGTGCTT AATTATCCTG TGAAAGGTGG CACTTTTGCG CTGTACTCGC TTCTGCGTCA GCATGTGAAT TTCAAGGGAA
ACATGCCAGT GCCAGTCACA CACTTGGCAT CTGACATCAA CCTCAAGTTC CACAGTAAGA AGAGGATTCT GACGTCCAAG
CTCCTCAAGT TCTTGGAACA AAGCACAAAA TGGCAGGCAG TCATTACCTA CATCGTGCTT GCTGGGACTT GCATGGTGCT
AGGAGATGGT GCCCTCACTC CAGCCATCTC AGGTGTGCAT ATCATATCCA GCCTTTTCTG ATTAGGCACT TATAAAGAGT
GTAGGATAAT AGTGTATATT TTTGTGAAGT TGTTAGCATC TCAACAGACG AAATGAAATg gtcctgttca ctctgatgtc
taccttacca aattttagta atgccaaaat tttacatgtt gcGGTTGTGA TGTGTAAGTA GTTTTTAGtt tgcaatcttt
gtcaagattt tgagagagat tctagaacta ccaaactttt agtggagtta atttttaaca gtgcttagtt tgttactttg
ccaaattttg gtaaagccaa aatttgatag ggttaatttt gacaacaaag ggaacagCCT CGAGGTGTTG TAGGGAGCAG
TTTTTGTGCC ATGCTAGCAT GTAGTTTGCA GATCAATTTT CATTGAATTT GAATGCCCTG ATGCATGTTT CTTTCTTAAA
AAATGTATTC AGTTCTGTCA GCTGTTCAAG GAATCCAATC AAGATCTTCA AGCATAACAC AAGGTAACAA CTAGTTGTTT
CTTCACCTTT GTATTGCCAA CCATTATAAT TTAGATAGTG GCATTCTTTC GCATGGCTAG AGAATAAAAA ATAAACTGAC
ATTCCTTCTC ATTGTTTCAG CTCATGTTGT GTTGCTATCT GTGATTATCT TGTTCATACT ATTCTTCTTC CAAAAACATG
GCACAAGCAA AGTCAGCTTC ACTTTTTCTC CCATTATGAT CTTGTGGTTT ACATTCGTTG CATTCATTGG ATTGTACAAT
ATCATCAAGC ACTATCCACC AATTCTGAAA GCTGTGTCGC CCCATTACAT AATCATATAC TTCATAAGGA ACAAAAGAGC
GGCCTGGGAG ACACTTGGAG CAATTGTTCT ATGCATAACA GGTTAGTAAT ATATCGAGAG AAAAAAAAAA CATCTACTAG
TTTTGCTTCT GGCCAATTAA TCTACTAATG ACTAAACAGC TGTACTCATA ATCAGGTGCT GAAGCTATGT TTGCTGACTT
GGGTCATTTC AACAAATCAT CAATCCAGGT ACATGCATGG TCATTAAATT TTAAATATAA TAACATAAGT ACTTACCGTG
ATCTTGAACT TTACCCTGTA TCCTGCAGAT GGCATTTTCA GTCATAGTTT ATCCATCAAT GATCCTTGCG TATGCCGGGC
AGGCAGCATT TTTGGTCAAG AACCCTTCAA AGCTCAGCAC GACGTTCTAC AGTAGTACTC CAGAGCCACT ATTTTGGCCC
ATGTTTATCA TAGCAACTTT GGCTGCTATT GTTGCGAGCC AAGCATTGAT ATCAGCCAGC TTCTCCATCA TTCGACAATC
AATTGCTTTG GGTTGTTTTC CAAGAGTTAC CATGAAGCAT ACCTCAGGCA AACAtgaagg ccaagtatac tctccagaga
tcaattactt tttgatggtt gcgtgcatct taattactgt tgggttTAAG GGTGGACCAG AGATAGGGCA AGCCTTTGGT
AAGCAATCTA ATCATATATA CTCTTGCCAT TTCTAATTGT TAATTTCTCT TTTACTTTTT GTATGAAAAT GTTGTAGTTG
CAGAGACTTC AAACTCATGA AAAAGGGCTA AATTGCACCC AACACATAAC ATTATAAATG TTTTTAACAT ACATATGTGC
TCGTGTGTGG TTGGTTGTCA AAACACAGAT GGGTATTGCA TAAAATTAAA AAAAAAAGTA TTCTATAGAA AAGCCATGTC
TAACCAGTTG GAATTATCAA GTTACTAGAA ACACCACTGC TGGTACCATA GAAACATCAA GGAGAGCACA TCTCTATTTG
GACAGATGTA AATGACAATA CTATGTGCTA AAAATTAACA CACATTTGTT GTCACCAGAC TGAATAATTT CTTATGGTCT
GCAGGCGTGG CAGTGATATT TGTTATGCTT TTTACAACAA ACCTGATGAC AGTGGTCATG CTTATAATAT GGGAAAGTAA
CATTGCACTT GCCAGTCTAT TTTTTGTTTT TTTCTTTTCC ATCGAAGGCA TTTACATGAC CTCGTTAATG AACAAGATTC
TACAAGGTGG CTGGGTTCCA TTTGCCATTA CTGCATTTTT CCTGATAATT ACACTATCTT GGACTTATGG AAGAAGTAAG
AAGGGTGAAT ATGAACTTGC CAATGTGATG GAAAGGGAGG AATTTATTAA GACAGTAACA ACGAGAAGCC GAGTACCTGG
AGTATGCATC TTCTGCACGG ATATGATGAA TGGCATCCCG CCGATTGTGC GCCATTATGT TCAGCATGTG GCTTCCCTCC
GTGAACTGAT GGTGTTTGTC ACTATCAGGG TTCTTCCGGT GAGAACTGTC CTTCCTGAAG AGCGCTTCAT CATAGACAAG
CTAGAGCCAG TGGGTGTCTA CAGGTGCATA GTCCAATATG GCTATATGGA CAACCACAAT ATGGAGGGTG ACGATTACGT
TGCATCAGTT ATTGCATCCC TCAAGGAAAT AGCTGAGAAT GATGATGAGA TTCTGGTGTT GGATTCAGCT TTGATAAATG
GATCAACCTT TGTTCTTGGC AGGACTATCA TAAAGATGGG AACTAGGCAC AACTGTTTGA AGCGCTTTTT TATTAATAAC
CTTTACAGGT TCTTGCAAAA GAACTTCAGA TCCAACATGT CCAGTCTAAA GATAAATCCT GGTAAAACCT TGCAAGTTGG
AATGCTATAT GAGATTTGAA GAAGGTGACC AATTGTGGAT GCATAAATGT GAAGTGTTAG CTAGAATGCT AGATTGCTGA
AATTGGCAGA CAGACAAGTT TTTCTTGATT ATAAATGTCA CAGAATTGTT TGGATGTGAC CCATATTTTC TTAGCATGCA
AACCATCTGC AATAATTGTC CTGTGAGTAG ATGACCAAGT TATATACACT TTTGGGATAA TTTTATTAGT GGGATGCAAT
TCTCTTTTTT TCTCCCCTAA TATTTCACAC TCTAAACTGC ACCAACTTGT AGGCTGGTTA GTGAATGGTA AAGAAAAAAT
GTTGCACAGT GTGCAATTTA TGTACACATA CCATTCTCAT TTATTTTCCA GTTGTATTTT GATAAGATGG TTATCTAAAT
CATATTCTTT GGTGAAAGTG TAAACCTCCT TGTAAAACAA TATAGATCTT AATGTTGCAA TGCTC

Locus: Os08g0510300

Loading...

Locus: Os08g0510300

Loading...