Os08t0512600-01

Locus

Os08g0512600

Description

B-type plant-specific cyclin-dependent kinase, DNA damage response

RAP-DB Gene Symbol Synonym(s)

CDKB2;1, Orysa;CDKB2;1, OsCDKB2;1, cdc2Os3, Orysa;CDKB;2

RAP-DB Gene Name Synonym(s)

CYCLIN-DEPENDENT KINASE B2;1, B-type cyclin-dependent kinase 2;1

CGSNL Gene Symbol

CDKB2;1

CGSNL Gene Name

CYCLIN-DEPENDENT KINASE B2;1

Oryzabase Gene Symbol Synonym(s)

Orysa;CDKB2;1, OsCDKB2;1, cdc2Os3, Oscdc20s-3, cdc20s-3, Orysa;CDKB;2, CYCB2.1

Oryzabase Gene Name Synonym(s)

B-type cyclin-dependent kinase 2;1

Transcript Evidence

AK059682

Protein Evidence

Q0J4I1

Literature

PMID: 22092531

PMID: 12753582

PMID: 10987556

Note

Manual Curation

March 16, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

001-031-H09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0512600-01)

RiceXPro (AK059682)

Others

Oryzabase (8984)

KEGG (Os08t0512600-01)

Transcript

1221 bp

>Os08t0512600-01 B-type plant-specific cyclin-dependent kinase, DNA damage response
CAAACCCTAAATCCACGCGCATTCCACACCACCCAACCAGCGAGAGAGAGATGGCGGCGC
TCCACCACCAGGCGGCGGCGGCGCCGGTGACGACGACGACGGACGGGGGCGAGCTGCGGG
CGATGGACCTGTACGAGAAGCtggagaaggtcggggaggggacgtacgggaaggtgtaca
aggcgcgggagaaggcgacggggcggatcgtggcgctgaagaagacgcggctgccGGAGG
ACGACGAGGGCGTGCCGCCGACGGCGCTCAGGGAGGTGTCGCTGCTGCGGATGCTGTCGC
AGGACTCGCACGTGGTGCGCCTGCTGGACCTCAAGCAGGGGCAGAACAAGGAGGGCCAGA
CCATCCTCTACCTCGTCTTCGAGTACATGGACACCGACCTCAAGAAGTTCATCCGCGCCC
ACCGCCAGAATCTCCAGAAGATCCCCGTGCCCACCGTCAAGATCCTGATGTACCAGCTCT
GCAAGGGCGTTGCTTTCTGCCATGGCCGCGGTGTGCTGCACCGTGACCTCAAGCCGCATA
ACCTGCTCATGGACCGCAAGACCATGGCGCTCAAGATCGCCGACCTCGGGCTCAGCCGCT
CGTTCACTGTCCCTCTCAAGAAGTACACCCACGAGATCCTGACGCTGTGGTACAGGGCTC
CCGAGGTTCTTCTTGGCGCGGCACACTACTCCACTCCGGTTGACATCTGGTCTGTGGGCT
GCATTTTTGCTGAGTTGGCCACTAACCAACCTCTTTTCGCTGGAGATTCCGAGGTTCAGC
AGCTTCTGCACATTTTCAAGTTGCTGGGCACCCCAAATGAGCAAGTTTGGCCAGGAGTGA
GCAAGCTACCTAACTGGCACGAGTACCCCCAGTGGAATCCCTCGAAAGTGTCTGATCTTG
TCCATGGTCTCGACGCTGATGCTCTTGATCTTCTTGAGAAAATGCTGCAGTACGAGCCGT
CGAAGCGGATCTCTGCGAAGAAGGCCATGGAGCATCCCTACTTCAACGACGTGAACAAGG
AGCTCTACTGAAGGTCGATTGATGATGTTCACCACCAAGGAAAAAAAAACGTTGTGCGTC
TTCGTGACTAGCCTGCCCTGAAGCATTGCTTTTGCTTCTAGGGGGAAAAGTACTGTTTGT
GTCTGTTTCCTGGATGCTGCTTAGTGTGCTTAAGAATTCACTTGTTTGTGATGGTAATGA
GTAATGACTTAAGAATTCGAC

CDS

981 bp

>Os08t0512600-01 B-type plant-specific cyclin-dependent kinase, DNA damage response
ATGGCGGCGCTCCACCACCAGGCGGCGGCGGCGCCGGTGACGACGACGACGGACGGGGGC
GAGCTGCGGGCGATGGACCTGTACGAGAAGCtggagaaggtcggggaggggacgtacggg
aaggtgtacaaggcgcgggagaaggcgacggggcggatcgtggcgctgaagaagacgcgg
ctgccGGAGGACGACGAGGGCGTGCCGCCGACGGCGCTCAGGGAGGTGTCGCTGCTGCGG
ATGCTGTCGCAGGACTCGCACGTGGTGCGCCTGCTGGACCTCAAGCAGGGGCAGAACAAG
GAGGGCCAGACCATCCTCTACCTCGTCTTCGAGTACATGGACACCGACCTCAAGAAGTTC
ATCCGCGCCCACCGCCAGAATCTCCAGAAGATCCCCGTGCCCACCGTCAAGATCCTGATG
TACCAGCTCTGCAAGGGCGTTGCTTTCTGCCATGGCCGCGGTGTGCTGCACCGTGACCTC
AAGCCGCATAACCTGCTCATGGACCGCAAGACCATGGCGCTCAAGATCGCCGACCTCGGG
CTCAGCCGCTCGTTCACTGTCCCTCTCAAGAAGTACACCCACGAGATCCTGACGCTGTGG
TACAGGGCTCCCGAGGTTCTTCTTGGCGCGGCACACTACTCCACTCCGGTTGACATCTGG
TCTGTGGGCTGCATTTTTGCTGAGTTGGCCACTAACCAACCTCTTTTCGCTGGAGATTCC
GAGGTTCAGCAGCTTCTGCACATTTTCAAGTTGCTGGGCACCCCAAATGAGCAAGTTTGG
CCAGGAGTGAGCAAGCTACCTAACTGGCACGAGTACCCCCAGTGGAATCCCTCGAAAGTG
TCTGATCTTGTCCATGGTCTCGACGCTGATGCTCTTGATCTTCTTGAGAAAATGCTGCAG
TACGAGCCGTCGAAGCGGATCTCTGCGAAGAAGGCCATGGAGCATCCCTACTTCAACGAC
GTGAACAAGGAGCTCTACTGA

Protein

327 aa

>Os08t0512600-01 B-type plant-specific cyclin-dependent kinase, DNA damage response
MAALHHQAAAAPVTTTTDGGELRAMDLYEKLEKVGEGTYGKVYKAREKATGRIVALKKTR
LPEDDEGVPPTALREVSLLRMLSQDSHVVRLLDLKQGQNKEGQTILYLVFEYMDTDLKKF
IRAHRQNLQKIPVPTVKILMYQLCKGVAFCHGRGVLHRDLKPHNLLMDRKTMALKIADLG
LSRSFTVPLKKYTHEILTLWYRAPEVLLGAAHYSTPVDIWSVGCIFAELATNQPLFAGDS
EVQQLLHIFKLLGTPNEQVWPGVSKLPNWHEYPQWNPSKVSDLVHGLDADALDLLEKMLQ
YEPSKRISAKKAMEHPYFNDVNKELY*

5'UTR

chr08:25419884..25419933 (+ strand) : 50 bp

CDS

chr08:25419934..25420344 (+ strand) : 411 bp

chr08:25420494..25420667 (+ strand) : 174 bp

chr08:25420780..25420873 (+ strand) : 94 bp

chr08:25420963..25421032 (+ strand) : 70 bp

chr08:25421139..25421277 (+ strand) : 139 bp

chr08:25421440..25421532 (+ strand) : 93 bp

3'UTR

chr08:25421533..25421722 (+ strand) : 190 bp

FASTA

>Os08t0512600-01 class=Sequence position=chr08:25419884..25421722 (+ strand)
CAAACCCTAA ATCCACGCGC ATTCCACACC ACCCAACCAG CGAGAGAGAG ATGGCGGCGC TCCACCACCA GGCGGCGGCG
GCGCCGGTGA CGACGACGAC GGACGGGGGC GAGCTGCGGG CGATGGACCT GTACGAGAAG Ctggagaagg tcggggaggg
gacgtacggg aaggtgtaca aggcgcggga gaaggcgacg gggcggatcg tggcgctgaa gaagacgcgg ctgccGGAGG
ACGACGAGGG CGTGCCGCCG ACGGCGCTCA GGGAGGTGTC GCTGCTGCGG ATGCTGTCGC AGGACTCGCA CGTGGTGCGC
CTGCTGGACC TCAAGCAGGG GCAGAACAAG GAGGGCCAGA CCATCCTCTA CCTCGTCTTC GAGTACATGG ACACCGACCT
CAAGAAGTTC ATCCGCGCCC ACCGCCAGAA TCTCCAGAAG ATCCCCGTGC CCACCGTCAA GGTATCCATC CGGCTACGAC
CGCTTCAGAT CTGGATCAGG GGTTCTTCTT CTTGTTTTTT TTTCCCGTGC ACGCGGGGTG TTTGTGTGAA TGCCTCGTCC
GTGTTTGTCT GGTTCGATGG GGGTGATTGA TGGGGGATGC GCTTGTGCAG ATCCTGATGT ACCAGCTCTG CAAGGGCGTT
GCTTTCTGCC ATGGCCGCGG TGTGCTGCAC CGTGACCTCA AGCCGCATAA CCTGCTCATG GACCGCAAGA CCATGGCGCT
CAAGATCGCC GACCTCGGGC TCAGCCGCTC GTTCACTGTC CCTCTCAAGA AGTACACCCA CGAGGTCCGG TTCCTACATC
CTACTACTAG CAGTCTCTAA TCTGCTTGGT GATCTGTTTC GCATGCGTGA TTTCTGTTCT TGGATCTCAC TGTGATGAAT
GGATTATTTT TCGCAGATCC TGACGCTGTG GTACAGGGCT CCCGAGGTTC TTCTTGGCGC GGCACACTAC TCCACTCCGG
TTGACATCTG GTCTGTGGGC TGCATTTTTG GTACGGTGAA CTGATATTTT GGCCACTGTA AATTATCATT TCTTCAGGAT
TCATGCCTTG ACATTGTTGA TATATCTTGT GCATTGCAGC TGAGTTGGCC ACTAACCAAC CTCTTTTCGC TGGAGATTCC
GAGGTTCAGC AGCTTCTGCA CATTTTCAAG TACTGTGCCT GTTTCCTCAT CAATTGTTCT TTGTGCTCGC TGGCATACTT
GAGGGGTATA ATCGTGTATT CATGGTGGTG ATTTATCTTG ATTGTTTGGT TCCAGGTTGC TGGGCACCCC AAATGAGCAA
GTTTGGCCAG GAGTGAGCAA GCTACCTAAC TGGCACGAGT ACCCCCAGTG GAATCCCTCG AAAGTGTCTG ATCTTGTCCA
TGGTCTCGAC GCTGATGCTC TTGATCTTCT TGAGGTTTGT ACTATGCTGC TTTTGCTCGT TGCTATACTT GATTATTTTC
TTCTACTTCA AAATCGATGT ACAATGTTAG GTGTAAACTG TATCATGAAC GTAAAATGGA AGAAAGGTGT TATCAATTGA
ATTGAATCCT GACATGGTTC TTGTTTTCGA TTGCAGAAAA TGCTGCAGTA CGAGCCGTCG AAGCGGATCT CTGCGAAGAA
GGCCATGGAG CATCCCTACT TCAACGACGT GAACAAGGAG CTCTACTGAA GGTCGATTGA TGATGTTCAC CACCAAGGAA
AAAAAAACGT TGTGCGTCTT CGTGACTAGC CTGCCCTGAA GCATTGCTTT TGCTTCTAGG GGGAAAAGTA CTGTTTGTGT
CTGTTTCCTG GATGCTGCTT AGTGTGCTTA AGAATTCACT TGTTTGTGAT GGTAATGAGT AATGACTTAA GAATTCGAC

Locus: Os08g0512600

Loading...

Locus: Os08g0512600

Loading...