Os08t0517300-01

Locus

Os08g0517300

Description

Zinc finger, C2H2-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ZOS8-11

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK069175 (DDBJ, Best hit)

Protein Evidence

Q94FY3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Arsenite-resistance protein 2 (IPR007042)

Zinc finger, C2H2 (IPR007087)

Protein of unknown function DUF3546 (IPR021933)

Full-length cDNA

J023007J12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0517300-01)

RiceXPro (AK069175)

Others

Oryzabase (12402)

KEGG (Os08t0517300-01)

Transcript

2264 bp

>Os08t0517300-01 Zinc finger, C2H2-like domain containing protein.
ctcttcgcatcgtcttcctccgccttccccgaatcccccgctccccgacaccacaccgcg
agatcctcctcttccagatcaagcacccaccctacctagggtttccaccccgccatggcc
gaggtcgcccgcgcctcggcttccccacctcccgcctccgcctccaccggcggcgaccgc
aagcgtggccgctcctccccgtcgctcccgccgccgccgcccgggccccctccgCAGGTC
CCGCATGGGAGCAAGAGGCACCGCAGGGACGAGGGGGGCGGGGGCGGGTTCGATCGGCGC
CGCCTCGGGCCGGGAGTAGGGTACGACAACCCGGACGATAGGAGGTATGGAAATGATCAT
GGTGGTGCAGGAGGAAGAGGTGGATATGGGGATGAGAGAGGTCAGGGTAGAAACTTCAAT
CGTGCACCAGATTGGACTGATTCTGGACGTGGTGGATGGAATGATGGCCCGGCTAACTCT
CGTAGGGAAGGCCTCATGTCTTACAAGCAGTTCATGCAGGAGCTTGAAGATGATGTTTCG
CCTGATGAAGCTCAACACAGATATGAGGAGTACAAGTCAGAGTACATAACAACTCAGAAG
AAAGCGTACTTTGACCTTCATAAGAACGACGACTGGCTGAAAAACAAGTACCATCCGACT
AACCTTGAAATTGTCATGGAAAGAAGGAATGAACTTGCACGAACTGCTGCAAATCAATTC
CTCCAAGATTTGCAGAATGGGAGTTTAGACATTGGTCCAGGATTAACAAGTTCTGCAACA
AACAAATCTGGGAATAGCGTAGATGATACGGATGCTAATGGAAAAAAGGGGAAACTTGGA
AAGAGCCAAGATGATTTATATTATGCTGCTCCTAAGGCTCATCCAGTTAGCTCTGAGCCC
CGTCGAATTAGAATTGACGTTGAGCTAGCTCAAGCTCTCATTTGTAAACTTGATTCAGAG
AAGGGTATTGAGAATAATGTTCTGTCAGGTAGTGATCATGACAGAGCAGAGAAAGATAAG
TCACATGGTTCAATGGGACCAATCGTAATAATACGGGGTTCATCTGCTGTAAAGGGTCTT
GAGGGTGCTGAGTTGCTGGACACTCTTGTTACCTATTTGTGGCGTATCCATGGTGTGGAT
TACTATGGGATGTCTGAGACAAATGAGCCCAAAGGTCTAAGGCATGTGAAAGCAGATTCA
AGGACGTTTAATGGGGCTAGCTCAAATGCAGCTGAATGGGAGAAGAAACTTGATTCCTTC
TGGCAAGATAGGATTCAAGGCCAGGATCCAATGGAAATATTGAAAGCAAAGGATAAGATT
GATGCAGCTGCTAGTGAAGTGCTGGATCCACATGTGAGAAAAATAAGGGATGAAAAGTAT
GGATGGAAATATGGCTGTGGAGCTAAGGGCTGCACAAAACTTTTCCATGCCCCTGAGTTT
GTCCAGAAGCATCTCAAACTCAAACATGCGGATTTGGTTAGGGAACTGACTTCGAAAGTG
AGAGAAAATATTTATTTTGATAACTATATGAGTGATCCCAAGGCACCTGGTGGGATGCCT
ATCATGCAGCAACCTGCTCCAAGGGAGAAAGTCAGACAGCGGCCACCAATAGAGAGTCGG
CTGAGAGATGAGCGTGGCAATCGTAGGTTTGATAGAAATGATTCACCAACCCATGATGGA
TCCAGTGACAACCCTGATGATGCATATGATTCTTATGGTGATCCGGTTATGCATGGCGCC
TTTCCTCCGGATATTCCTGCTCCTCCAGTGTTGATGCCTGTGCCTGGTGCTGGCCCACTA
GGACCATTTATTCCTGCACCACCTGAAGTTGCTATGCGTATGATGAGAGATCAGGGTGGA
CCACCACCTTTTGAGCCAACTGGTGGTCCACGTCCTAGGAGACCAGGGAGGGGTGGTCTT
CCAATGGGTGGCCCATCACCAATTCTTGCTGCTCCTTTACCACCCCCTCATATGCATGAT
CCACGCAAAATACGAAGCTATCAAGACCTTGATGCTCCTGAAGATGAAGTGACTGTTATG
GACTACCGAAGCTTGTAGAGGAATTGGAGACACGATCCTTTTTTGTATCTGGGAAACTGT
AGGTAATATTACAGACCGCAACAAGACGGCATTCATTTCTAGATTTTTTTGTGAACGCAA
ACAGGTAGGACTTTGAGGTTCGGAGCTCTGTTACTGTCTGTAAAATGGATCACAGGAAAA
CCTGGGACAAGGAGCATATTCTCATTCACCAATCACCACTCACC

CDS

1944 bp

>Os08t0517300-01 Zinc finger, C2H2-like domain containing protein.
atggccgaggtcgcccgcgcctcggcttccccacctcccgcctccgcctccaccggcggc
gaccgcaagcgtggccgctcctccccgtcgctcccgccgccgccgcccgggccccctccg
CAGGTCCCGCATGGGAGCAAGAGGCACCGCAGGGACGAGGGGGGCGGGGGCGGGTTCGAT
CGGCGCCGCCTCGGGCCGGGAGTAGGGTACGACAACCCGGACGATAGGAGGTATGGAAAT
GATCATGGTGGTGCAGGAGGAAGAGGTGGATATGGGGATGAGAGAGGTCAGGGTAGAAAC
TTCAATCGTGCACCAGATTGGACTGATTCTGGACGTGGTGGATGGAATGATGGCCCGGCT
AACTCTCGTAGGGAAGGCCTCATGTCTTACAAGCAGTTCATGCAGGAGCTTGAAGATGAT
GTTTCGCCTGATGAAGCTCAACACAGATATGAGGAGTACAAGTCAGAGTACATAACAACT
CAGAAGAAAGCGTACTTTGACCTTCATAAGAACGACGACTGGCTGAAAAACAAGTACCAT
CCGACTAACCTTGAAATTGTCATGGAAAGAAGGAATGAACTTGCACGAACTGCTGCAAAT
CAATTCCTCCAAGATTTGCAGAATGGGAGTTTAGACATTGGTCCAGGATTAACAAGTTCT
GCAACAAACAAATCTGGGAATAGCGTAGATGATACGGATGCTAATGGAAAAAAGGGGAAA
CTTGGAAAGAGCCAAGATGATTTATATTATGCTGCTCCTAAGGCTCATCCAGTTAGCTCT
GAGCCCCGTCGAATTAGAATTGACGTTGAGCTAGCTCAAGCTCTCATTTGTAAACTTGAT
TCAGAGAAGGGTATTGAGAATAATGTTCTGTCAGGTAGTGATCATGACAGAGCAGAGAAA
GATAAGTCACATGGTTCAATGGGACCAATCGTAATAATACGGGGTTCATCTGCTGTAAAG
GGTCTTGAGGGTGCTGAGTTGCTGGACACTCTTGTTACCTATTTGTGGCGTATCCATGGT
GTGGATTACTATGGGATGTCTGAGACAAATGAGCCCAAAGGTCTAAGGCATGTGAAAGCA
GATTCAAGGACGTTTAATGGGGCTAGCTCAAATGCAGCTGAATGGGAGAAGAAACTTGAT
TCCTTCTGGCAAGATAGGATTCAAGGCCAGGATCCAATGGAAATATTGAAAGCAAAGGAT
AAGATTGATGCAGCTGCTAGTGAAGTGCTGGATCCACATGTGAGAAAAATAAGGGATGAA
AAGTATGGATGGAAATATGGCTGTGGAGCTAAGGGCTGCACAAAACTTTTCCATGCCCCT
GAGTTTGTCCAGAAGCATCTCAAACTCAAACATGCGGATTTGGTTAGGGAACTGACTTCG
AAAGTGAGAGAAAATATTTATTTTGATAACTATATGAGTGATCCCAAGGCACCTGGTGGG
ATGCCTATCATGCAGCAACCTGCTCCAAGGGAGAAAGTCAGACAGCGGCCACCAATAGAG
AGTCGGCTGAGAGATGAGCGTGGCAATCGTAGGTTTGATAGAAATGATTCACCAACCCAT
GATGGATCCAGTGACAACCCTGATGATGCATATGATTCTTATGGTGATCCGGTTATGCAT
GGCGCCTTTCCTCCGGATATTCCTGCTCCTCCAGTGTTGATGCCTGTGCCTGGTGCTGGC
CCACTAGGACCATTTATTCCTGCACCACCTGAAGTTGCTATGCGTATGATGAGAGATCAG
GGTGGACCACCACCTTTTGAGCCAACTGGTGGTCCACGTCCTAGGAGACCAGGGAGGGGT
GGTCTTCCAATGGGTGGCCCATCACCAATTCTTGCTGCTCCTTTACCACCCCCTCATATG
CATGATCCACGCAAAATACGAAGCTATCAAGACCTTGATGCTCCTGAAGATGAAGTGACT
GTTATGGACTACCGAAGCTTGTAG

Protein

647 aa

>Os08t0517300-01 Zinc finger, C2H2-like domain containing protein.
MAEVARASASPPPASASTGGDRKRGRSSPSLPPPPPGPPPQVPHGSKRHRRDEGGGGGFD
RRRLGPGVGYDNPDDRRYGNDHGGAGGRGGYGDERGQGRNFNRAPDWTDSGRGGWNDGPA
NSRREGLMSYKQFMQELEDDVSPDEAQHRYEEYKSEYITTQKKAYFDLHKNDDWLKNKYH
PTNLEIVMERRNELARTAANQFLQDLQNGSLDIGPGLTSSATNKSGNSVDDTDANGKKGK
LGKSQDDLYYAAPKAHPVSSEPRRIRIDVELAQALICKLDSEKGIENNVLSGSDHDRAEK
DKSHGSMGPIVIIRGSSAVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHVKA
DSRTFNGASSNAAEWEKKLDSFWQDRIQGQDPMEILKAKDKIDAAASEVLDPHVRKIRDE
KYGWKYGCGAKGCTKLFHAPEFVQKHLKLKHADLVRELTSKVRENIYFDNYMSDPKAPGG
MPIMQQPAPREKVRQRPPIESRLRDERGNRRFDRNDSPTHDGSSDNPDDAYDSYGDPVMH
GAFPPDIPAPPVLMPVPGAGPLGPFIPAPPEVAMRMMRDQGGPPPFEPTGGPRPRRPGRG
GLPMGGPSPILAAPLPPPHMHDPRKIRSYQDLDAPEDEVTVMDYRSL*

5'UTR

chr08:25682231..25682344 (- strand) : 114 bp

CDS

chr08:25682001..25682230 (- strand) : 230 bp

chr08:25681173..25681258 (- strand) : 86 bp

chr08:25680856..25680910 (- strand) : 55 bp

chr08:25680480..25680554 (- strand) : 75 bp

chr08:25680295..25680369 (- strand) : 75 bp

chr08:25680149..25680196 (- strand) : 48 bp

chr08:25679938..25680006 (- strand) : 69 bp

chr08:25679075..25679854 (- strand) : 780 bp

chr08:25678943..25678991 (- strand) : 49 bp

chr08:25678642..25678853 (- strand) : 212 bp

chr08:25678366..25678569 (- strand) : 204 bp

chr08:25677334..25677394 (- strand) : 61 bp

3'UTR

chr08:25677128..25677333 (- strand) : 206 bp

FASTA

>Os08t0517300-01 class=Sequence position=chr08:25677128..25682344 (- strand)
ctcttcgcat cgtcttcctc cgccttcccc gaatcccccg ctccccgaca ccacaccgcg agatcctcct cttccagatc
aagcacccac cctacctagg gtttccaccc cgccatggcc gaggtcgccc gcgcctcggc ttccccacct cccgcctccg
cctccaccgg cggcgaccgc aagcgtggcc gctcctcccc gtcgctcccg ccgccgccgc ccgggccccc tccgCAGGTC
CCGCATGGGA GCAAGAGGCA CCGCAGGGAC GAGGGGGGCG GGGGCGGGTT CGATCGGCGC CGCCTCGGGC CGGGAGTAGG
GTACGACAAC CCGGACGATA GGAGGTGAGA GGGTTTGTGA TGCTTTGGTG GTGTGGAGTT GGGAGGGTTT GAGTTGAGTT
TGATAGCTGG AGAGAAATAG AAGCTTCCGA CTCATTTTTT TTTTGTTTGG ACTGTTAGTT TATATGGTCG ATTGATGTGC
GAAAACCGTG GTCGTTAGAT TGGTTTAGCC ATGAAAAAAA ATGTTGAGTG CGCAATGAGC AGTTCGAATG CGTCCCATTT
TTTTCATTCG GAAACAGTAG GTTTTGGACT AGGAAATTAA TGACTGAAGA GATTTATGTT TGTTGCAGTT TTCCACAATT
TAGGATTTTG GCCAGAAGAC GTTTTTCATC TGCCACATGG GTAGTCTGTG AATGTCTTGT AGTAGCTCGA TGTTTAGCTC
CTGGTTGAAT CCCAGTAAGA CCATAAGAGC CTGAGCTATT GAAGGCACTG GCTGTGCTTA TTAGTCAACT GAAAGTGTTA
GTAATTTGGG TAGGATACCA AAAAGGATCC TGAATTTGAC TCTTATATAT GAAGTAAACA TATATGGTGA AGTGCTACAT
CTCATTTTCT TGTGGATTTA TGGTACCTCT TCGCCTTTTC GTATGGTATT TATGTGCTAT TTTGAGTTGG GAGCTGCTCT
ATGTGTTATA ACATTTAGCA GGAATTAAGG AAATTAATGG TTCTGGTTCC TTGTGATATT TCTTTCTGTG ATTATACACT
ATTTTGAGCA TCACTGCAGC TTTTAATTTG TTTGGTTATC TCCTAGGTAT GGAAATGATC ATGGTGGTGC AGGAGGAAGA
GGTGGATATG GGGATGAGAG AGGTCAGGGT AGAAACTTCA ATCGTGCACC AGGTACACAT TAGTTTATGC AAGATGTCTT
GTATCCACTA GTTGTCTGGT TTAAGTCCTA CATGAGTTGG AATATTTTAG ATTTAGTTCA TTTTCCTTGC TTATATAATA
CTATCGTTCC TGTCTTTATT CGGAGTATAA ATTATGTCCT GTCCACTTGA AATATGTAGA TAAAATCATA ACATACTGTG
TACAAAAAAT ATTTCATGTC TACTTGAGTT ACTTGTAGAT TGAAGTGTCT GTCAATGACA TATATTTTGT GTAGATTGGA
CTGATTCTGG ACGTGGTGGA TGGAATGATG GCCCGGCTAA CTCTCGTAGG TATGTATGCA ATTCTGGATT GCCTTAATCC
TGTATTTTGA TTTTTTTTCT AATTTTTTCA ATCACGAATT GTACCTACTG AGATGAGACA TTTATGAGAC TGGCACATGC
TGCGATGCCT ATACTATAAA AATTACAAAA CTTCTAGTTG GTGCACTGTC AAATTTATGA GTAACTGAAC TAGTCATACA
TTCAAGTGGT GTTCTTTGAG TATACGCATA CATTGGATTC TTGTGTAAGC ATCACAATGC AAAATTTTTG CATGTGGAAA
GCAAGCAAAA TGACTACTGG TACTCTACAG GGAAGGCCTC ATGTCTTACA AGCAGTTCAT GCAGGAGCTT GAAGATGATG
TTTCGCCTGA TGAAGCTCAA CACAGGTATG CTATGTTTGA GATGATGAAT TTTATTCCGT CCTACAGTGT ACCTTCAAAT
ATGGTGGCTC ACACAATATG TAATTGCCAT TGCTGCTGTT TGTGCTAATC ATTAGATATG AGGAGTACAA GTCAGAGTAC
ATAACAACTC AGAAGAAAGC GTACTTTGAC CTTCATAAGA ACGACGACTG GTAATACCTT TTTCTTTTAC ATCCTTTCCA
TGAATAATCT AATGACTGAT TTTTTTTTCA CCAAGTTTTA CTCTTTGCAC TTCTTGCTTT TGTTGCAGGC TGAAAAACAA
GTACCATCCG ACTAACCTTG AAATTGTCAT GGAAAGGTTA GCTGTTTATT TAGTATTTAG TGAATTTTCA AGATTATGGT
GGACTATCTT CTCATATTCA TTGTGTCTCC AATGTCCATA TCATCTCCAC TTTCTTGTAC GTTTATATGA TAACTACATT
ATCTTTTGTT TGAAGCAGAA GGAATGAACT TGCACGAACT GCTGCAAATC AATTCCTCCA AGATTTGCAG AATGGGAGTT
TAGACATGTG AGATGCTCCT CCCCCCCCTC TCCTTCTCTC TCTCTATCTC CCTCTCTATT TTACTTAATT TTATTGGCCA
CTCTGTGCAG TGGTCCAGGA TTAACAAGTT CTGCAACAAA CAAATCTGGG AATAGCGTAG ATGATACGGA TGCTAATGGA
AAAAAGGGGA AACTTGGAAA GAGCCAAGAT GATTTATATT ATGCTGCTCC TAAGGCTCAT CCAGTTAGCT CTGAGCCCCG
TCGAATTAGA ATTGACGTTG AGCTAGCTCA AGCTCTCATT TGTAAACTTG ATTCAGAGAA GGGTATTGAG AATAATGTTC
TGTCAGGTAG TGATCATGAC AGAGCAGAGA AAGATAAGTC ACATGGTTCA ATGGGACCAA TCGTAATAAT ACGGGGTTCA
TCTGCTGTAA AGGGTCTTGA GGGTGCTGAG TTGCTGGACA CTCTTGTTAC CTATTTGTGG CGTATCCATG GTGTGGATTA
CTATGGGATG TCTGAGACAA ATGAGCCCAA AGGTCTAAGG CATGTGAAAG CAGATTCAAG GACGTTTAAT GGGGCTAGCT
CAAATGCAGC TGAATGGGAG AAGAAACTTG ATTCCTTCTG GCAAGATAGG ATTCAAGGCC AGGATCCAAT GGAAATATTG
AAAGCAAAGG ATAAGATTGA TGCAGCTGCT AGTGAAGTGC TGGATCCACA TGTGAGAAAA ATAAGGGATG AAAAGTATGG
ATGGAAATAT GGCTGTGGAG CTAAGGGCTG CACAAAACTT TTCCATGCCC CTGAGTTTGT CCAGAAGCAT CTCAAACTCA
AACATGCGGA TTTGGTTAGG GAACTGACTT CGAAAGTGAG AGAAAATATT TATTTTGATA ACTATATGAG GTATGTTTTC
TTCATTGTCA TTCTTTTGGC TGAACTAATT TTTAACATTC CAAAGAAGAT TATGCTGTAC ATATTGCATG CAGTGATCCC
AAGGCACCTG GTGGGATGCC TATCATGCAG CAACCTGCTC CAGTAAGCCT CACTACCTAG TTTTTAGTCA GTTGCAAATT
GGTGACTGTT TAAGTTCCTT ACTGTCTTGT TTGTATTGGC CAATTTTTCA GAGGGAGAAA GTCAGACAGC GGCCACCAAT
AGAGAGTCGG CTGAGAGATG AGCGTGGCAA TCGTAGGTTT GATAGAAATG ATTCACCAAC CCATGATGGA TCCAGTGACA
ACCCTGATGA TGCATATGAT TCTTATGGTG ATCCGGTTAT GCATGGCGCC TTTCCTCCGG ATATTCCTGC TCCTCCAGTG
TTGATGCCTG TGCCTGGTGC TGGGTAAGTC TGCAACTTGT GCTTAGTTTT CACAATAATA CACTTATTGT TGATTCGTTG
TCATTTTCAT CTCAGCCCAC TAGGACCATT TATTCCTGCA CCACCTGAAG TTGCTATGCG TATGATGAGA GATCAGGGTG
GACCACCACC TTTTGAGCCA ACTGGTGGTC CACGTCCTAG GAGACCAGGG AGGGGTGGTC TTCCAATGGG TGGCCCATCA
CCAATTCTTG CTGCTCCTTT ACCACCCCCT CATATGCATG ATCCACGCAA AATACGAAGG TTAGTACTTA CATGTTTGTC
TCCTTTCCCT TGTGTTCCCT ATTCTGTCCT CACCATGCGA CATAAGCAAT TTATTTCAAT ATCCTGAAAC ATCGTTAACA
AAATAAGTAT GCTGATAGTG AAAAAACTGA ACACTGATTA TTTCTCTGGA GTTCTGCTGG ACATCCTTTG TCGTAATTTA
CCGTGATATG CAAATATTTC TTTAGAGAAA AGGCTGCAAT GACCTGGCTT GTATTGAAAG CCAAAAGGTT GTCTGCTGGG
GATTCCAGCT TTACATGTGT ATCACAGGAA ACCTAAACTG ATTACACCCT GATCAAGTAG GTATCGCCCA GAGCCAAGCA
AAAACTGAGG TCTTAAACAA CCAGACTACA GTACTAGGGA TATAACAACT CCCAAAAACA GAATCCCAGA CTACTGTAGC
GAAGCTGGCA CGGCATTTGA CCATGATATG CAAATATCTC AAGTTCACTA CGAAATTTGG ATGATCCGCT TGCAAATTTG
AGCTCATTAG CAGAACACGC GATTGATTTG GATTTCATAT ACCTGGAACA AACATGGCCA TGTCACAATT CACAAAGGAC
CTTACATACA GTTTGAAGCA TGGTAAAACA TGCTCCTGGT ATTGTTTGTA GAGTCTCTTG GCTAGGAAAT TTTTAAAAAA
CTTATTAGGA TAGGATGTCA AGTTGGTGTT TCCAATATAG TCTGATTTGT GCTTGCTAAA GCATTTGCAA GATGTACAAT
ACGTTATCAT GGAGATTGTT TGTCAGATTT AAGGTATTGC TGTTCCCTGC TGCATGTAGG TTTGCGAACT TTATGTTCTA
ACCAAAATTT GTCCCCTATA CATGTCTACC AAGTTGTATT TGAAGTTAGC ACTGGCACAT CATATCTGAA CTTCAGAATA
CTCATTTGCT GTTTATTTTA GATACTTATT TTTTGCTACA ATTTTTCACA TGTGTTAACC TTGCTTCCAG CTATCAAGAC
CTTGATGCTC CTGAAGATGA AGTGACTGTT ATGGACTACC GAAGCTTGTA GAGGAATTGG AGACACGATC CTTTTTTGTA
TCTGGGAAAC TGTAGGTAAT ATTACAGACC GCAACAAGAC GGCATTCATT TCTAGATTTT TTTGTGAACG CAAACAGGTA
GGACTTTGAG GTTCGGAGCT CTGTTACTGT CTGTAAAATG GATCACAGGA AAACCTGGGA CAAGGAGCAT ATTCTCATTC
ACCAATCACC ACTCACC

Locus: Os08g0517300

Loading...

Locus: Os08g0517300

Loading...