Os08t0517300-02

Locus

Os08g0517300

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ZOS8-11

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK120996 (DDBJ, Best hit)

Protein Evidence

B8B8W4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF3546 (IPR021933)

Full-length cDNA

J023044G03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0517300-02)

RiceXPro (AK120996)

Others

Oryzabase (12402)

KEGG (Os08t0517300-02)

Transcript

2849 bp

>Os08t0517300-02 Hypothetical conserved gene.
tcgtcttcctccgccttccccgaatcccccgctccccgacaccacaccgcgagatcctcc
tcttccagatcaagcacccaccctacctagggtttccaccccgccatggccgaggtcgcc
cgcgcctcggcttccccacctcccgcctccgcctccaccggcggcgaccgcaagcgtggc
cgctcctccccgtcgctcccgccgccgccgcccgggccccctccgCAGGTCCCGCATGGG
AGCAAGAGGCACCGCAGGGACGAGGGGGGCGGGGGCGGGTTCGATCGGCGCCGCCTCGGG
CCGGGAGTAGGGTACGACAACCCGGACGATAGGAGGTATGGAAATGATCATGGTGGTGCA
GGAGGAAGAGGTGGATATGGGGATGAGAGAGGTCAGGGTAGAAACTTCAATCGTGCACCA
GATTGGACTGATTCTGGACGTGGTGGATGGAATGATGGCCCGGCTAACTCTCGTAGGGAA
GGCCTCATGTCTTACAAGCAGTTCATGCAGGAGCTTGAAGATGATGTTTCGCCTGATGAA
GCTCAACACAGATATGAGGAGTACAAGTCAGAGTACATAACAACTCAGAAGAAAGCGTAC
TTTGACCTTCATAAGAACGACGACTGGCTGAAAAACAAGTACCATCCGACTAACCTTGAA
ATTGTCATGGAAAGGTTAGCTGTTTATTTAGTATTTAGTGAATTTTCAAGATTATGGTGG
ACTATCTTCTCATATTCATTGTGTCTCCAATGTCCATATCATCTCCACTTTCTTGTACGT
TTATATGATAACTACATTATCTTTTGTTTGAAGCAGAAGGAATGAACTTGCACGAACTGC
TGCAAATCAATTCCTCCAAGATTTGCAGAATGGGAGTTTAGACATTGGTCCAGGATTAAC
AAGTTCTGCAACAAACAAATCTGGGAATAGCGTAGATGATACGGATGCTAATGGAAAAAA
GGGGAAACTTGGAAAGAGCCAAGATGATTTATATTATGCTGCTCCTAAGGCTCATCCAGT
TAGCTCTGAGCCCCGTCGAATTAGAATTGACGTTGAGCTAGCTCAAGCTCTCATTTGTAA
ACTTGATTCAGAGAAGGGTATTGAGAATAATGTTCTGTCAGGTAGTGATCATGACAGAGC
AGAGAAAGATAAGTCACATGGTTCAATGGGACCAATCGTAATAATACGGGGTTCATCTGC
TGTAAAGGGTCTTGAGGGTGCTGAGTTGCTGGACACTCTTGTTACCTATTTGTGGCGTAT
CCATGGTGTGGATTACTATGGGATGTCTGAGACAAATGAGCCCAAAGGTCTAAGGCATGT
GAAAGCAGATTCAAGGACGTTTAATGGGGCTAGCTCAAATGCAGCTGAATGGGAGAAGAA
ACTTGATTCCTTCTGGCAAGATAGGATTCAAGGCCAGGATCCAATGGAAATATTGAAAGC
AAAGGATAAGATTGATGCAGCTGCTAGTGAAGTGCTGGATCCACATGTGAGAAAAATAAG
GGATGAAAAGTATGGATGGAAATATGGCTGTGGAGCTAAGGGCTGCACAAAACTTTTCCA
TGCCCCTGAGTTTGTCCAGAAGCATCTCAAACTCAAACATGCGGATTTGGTTAGGGAACT
GACTTCGAAAGTGAGAGAAAATATTTATTTTGATAACTATATGAGGTATGTTTTCTTCAT
TGTCATTCTTTTGGCTGAACTAATTTTTAACATTCCAAAGAAGATTATGCTGTACATATT
GCATGCAGTGATCCCAAGGCACCTGGTGGGATGCCTATCATGCAGCAACCTGCTCCAAGG
GAGAAAGTCAGACAGCGGCCACCAATAGAGAGTCGGCTGAGAGATGAGCGTGGCAATCGT
AGGTTTGATAGAAATGATTCACCAACCCATGATGGATCCAGTGACAACCCTGATGATGCA
TATGATTCTTATGGTGATCCGGTTATGCATGGCGCCTTTCCTCCGGATATTCCTGCTCCT
CCAGTGTTGATGCCTGTGCCTGGTGCTGGCCCACTAGGACCATTTATTCCTGCACCACCT
GAAGTTGCTATGCGTATGATGAGAGATCAGGGTGGACCACCACCTTTTGAGCCAACTGGT
GGTCCACGTCCTAGGAGACCAGGGAGGGGTGGTCTTCCAATGGGTGGCCCATCACCAATT
CTTGCTGCTCCTTTACCACCCCCTCATATGCATGATCCACGCAAAATACGAAGCTATCAA
GACCTTGATGCTCCTGAAGATGAAGTGACTGTTATGGACTACCGAAGCTTGTAGAGGAAT
TGGAGACACGATCCTTTTTTGTATCTGGGAAACTGTAGGTAATATTACAGACCGCAACAA
GACGGCATTCATTTCTAGATTTTTTTGTGAACGCAAACAGGTAGGACTTTGAGGTTCGGA
GCTCTGTTACTGTCTGTAAAATGGATCACAGGAAAACCTGGGACAAGGAGCATATTCTCA
TTCACCAATCACCACTCACCTGAAAAGAAAACATTGTGAAGTTTGTTCTTTGCAAAAAAG
TTCCTAGCACTGTCCATTCCAACCAAATGTCTACAAGCCTGCCATATCATCAGGTATTCG
TACCGTATTTGTATATTCAGCTACTGGGTGTGAGTAGATTGGAACCTGATACATCGGCGT
ATGCACAGACTTTCTATGAAGCCCGTTATGAAGAACATTTGTTCCCCATCTGCTAAGTTT
GAGTTCAACCTTGTCAGCTTGAAGAGTGTCCCAGTTCACCAGTCAGTATTGTATCAGTTC
TTGCCATTTGATCAAGCTTAGTGTTGTCCCATTCCTTACCATTGATGAAGCTTCTGTCAA
AATGGGAATATATACACCTCGGATGACTG

CDS

720 bp

>Os08t0517300-02 Hypothetical conserved gene.
atggccgaggtcgcccgcgcctcggcttccccacctcccgcctccgcctccaccggcggc
gaccgcaagcgtggccgctcctccccgtcgctcccgccgccgccgcccgggccccctccg
CAGGTCCCGCATGGGAGCAAGAGGCACCGCAGGGACGAGGGGGGCGGGGGCGGGTTCGAT
CGGCGCCGCCTCGGGCCGGGAGTAGGGTACGACAACCCGGACGATAGGAGGTATGGAAAT
GATCATGGTGGTGCAGGAGGAAGAGGTGGATATGGGGATGAGAGAGGTCAGGGTAGAAAC
TTCAATCGTGCACCAGATTGGACTGATTCTGGACGTGGTGGATGGAATGATGGCCCGGCT
AACTCTCGTAGGGAAGGCCTCATGTCTTACAAGCAGTTCATGCAGGAGCTTGAAGATGAT
GTTTCGCCTGATGAAGCTCAACACAGATATGAGGAGTACAAGTCAGAGTACATAACAACT
CAGAAGAAAGCGTACTTTGACCTTCATAAGAACGACGACTGGCTGAAAAACAAGTACCAT
CCGACTAACCTTGAAATTGTCATGGAAAGGTTAGCTGTTTATTTAGTATTTAGTGAATTT
TCAAGATTATGGTGGACTATCTTCTCATATTCATTGTGTCTCCAATGTCCATATCATCTC
CACTTTCTTGTACGTTTATATGATAACTACATTATCTTTTGTTTGAAGCAGAAGGAATGA

Protein

239 aa

>Os08t0517300-02 Hypothetical conserved gene.
MAEVARASASPPPASASTGGDRKRGRSSPSLPPPPPGPPPQVPHGSKRHRRDEGGGGGFD
RRRLGPGVGYDNPDDRRYGNDHGGAGGRGGYGDERGQGRNFNRAPDWTDSGRGGWNDGPA
NSRREGLMSYKQFMQELEDDVSPDEAQHRYEEYKSEYITTQKKAYFDLHKNDDWLKNKYH
PTNLEIVMERLAVYLVFSEFSRLWWTIFSYSLCLQCPYHLHFLVRLYDNYIIFCLKQKE*

5'UTR

chr08:25682231..25682335 (- strand) : 105 bp

CDS

chr08:25682001..25682230 (- strand) : 230 bp

chr08:25681173..25681258 (- strand) : 86 bp

chr08:25680856..25680910 (- strand) : 55 bp

chr08:25680480..25680554 (- strand) : 75 bp

chr08:25680295..25680369 (- strand) : 75 bp

chr08:25679998..25680196 (- strand) : 199 bp

3'UTR

chr08:25679938..25679997 (- strand) : 60 bp

chr08:25678943..25679854 (- strand) : 912 bp

chr08:25678642..25678853 (- strand) : 212 bp

chr08:25678366..25678569 (- strand) : 204 bp

chr08:25676759..25677394 (- strand) : 636 bp

FASTA

>Os08t0517300-02 class=Sequence position=chr08:25676759..25682335 (- strand)
tcgtcttcct ccgccttccc cgaatccccc gctccccgac accacaccgc gagatcctcc tcttccagat caagcaccca
ccctacctag ggtttccacc ccgccatggc cgaggtcgcc cgcgcctcgg cttccccacc tcccgcctcc gcctccaccg
gcggcgaccg caagcgtggc cgctcctccc cgtcgctccc gccgccgccg cccgggcccc ctccgCAGGT CCCGCATGGG
AGCAAGAGGC ACCGCAGGGA CGAGGGGGGC GGGGGCGGGT TCGATCGGCG CCGCCTCGGG CCGGGAGTAG GGTACGACAA
CCCGGACGAT AGGAGGTGAG AGGGTTTGTG ATGCTTTGGT GGTGTGGAGT TGGGAGGGTT TGAGTTGAGT TTGATAGCTG
GAGAGAAATA GAAGCTTCCG ACTCATTTTT TTTTTGTTTG GACTGTTAGT TTATATGGTC GATTGATGTG CGAAAACCGT
GGTCGTTAGA TTGGTTTAGC CATGAAAAAA AATGTTGAGT GCGCAATGAG CAGTTCGAAT GCGTCCCATT TTTTTCATTC
GGAAACAGTA GGTTTTGGAC TAGGAAATTA ATGACTGAAG AGATTTATGT TTGTTGCAGT TTTCCACAAT TTAGGATTTT
GGCCAGAAGA CGTTTTTCAT CTGCCACATG GGTAGTCTGT GAATGTCTTG TAGTAGCTCG ATGTTTAGCT CCTGGTTGAA
TCCCAGTAAG ACCATAAGAG CCTGAGCTAT TGAAGGCACT GGCTGTGCTT ATTAGTCAAC TGAAAGTGTT AGTAATTTGG
GTAGGATACC AAAAAGGATC CTGAATTTGA CTCTTATATA TGAAGTAAAC ATATATGGTG AAGTGCTACA TCTCATTTTC
TTGTGGATTT ATGGTACCTC TTCGCCTTTT CGTATGGTAT TTATGTGCTA TTTTGAGTTG GGAGCTGCTC TATGTGTTAT
AACATTTAGC AGGAATTAAG GAAATTAATG GTTCTGGTTC CTTGTGATAT TTCTTTCTGT GATTATACAC TATTTTGAGC
ATCACTGCAG CTTTTAATTT GTTTGGTTAT CTCCTAGGTA TGGAAATGAT CATGGTGGTG CAGGAGGAAG AGGTGGATAT
GGGGATGAGA GAGGTCAGGG TAGAAACTTC AATCGTGCAC CAGGTACACA TTAGTTTATG CAAGATGTCT TGTATCCACT
AGTTGTCTGG TTTAAGTCCT ACATGAGTTG GAATATTTTA GATTTAGTTC ATTTTCCTTG CTTATATAAT ACTATCGTTC
CTGTCTTTAT TCGGAGTATA AATTATGTCC TGTCCACTTG AAATATGTAG ATAAAATCAT AACATACTGT GTACAAAAAA
TATTTCATGT CTACTTGAGT TACTTGTAGA TTGAAGTGTC TGTCAATGAC ATATATTTTG TGTAGATTGG ACTGATTCTG
GACGTGGTGG ATGGAATGAT GGCCCGGCTA ACTCTCGTAG GTATGTATGC AATTCTGGAT TGCCTTAATC CTGTATTTTG
ATTTTTTTTC TAATTTTTTC AATCACGAAT TGTACCTACT GAGATGAGAC ATTTATGAGA CTGGCACATG CTGCGATGCC
TATACTATAA AAATTACAAA ACTTCTAGTT GGTGCACTGT CAAATTTATG AGTAACTGAA CTAGTCATAC ATTCAAGTGG
TGTTCTTTGA GTATACGCAT ACATTGGATT CTTGTGTAAG CATCACAATG CAAAATTTTT GCATGTGGAA AGCAAGCAAA
ATGACTACTG GTACTCTACA GGGAAGGCCT CATGTCTTAC AAGCAGTTCA TGCAGGAGCT TGAAGATGAT GTTTCGCCTG
ATGAAGCTCA ACACAGGTAT GCTATGTTTG AGATGATGAA TTTTATTCCG TCCTACAGTG TACCTTCAAA TATGGTGGCT
CACACAATAT GTAATTGCCA TTGCTGCTGT TTGTGCTAAT CATTAGATAT GAGGAGTACA AGTCAGAGTA CATAACAACT
CAGAAGAAAG CGTACTTTGA CCTTCATAAG AACGACGACT GGTAATACCT TTTTCTTTTA CATCCTTTCC ATGAATAATC
TAATGACTGA TTTTTTTTTC ACCAAGTTTT ACTCTTTGCA CTTCTTGCTT TTGTTGCAGG CTGAAAAACA AGTACCATCC
GACTAACCTT GAAATTGTCA TGGAAAGGTT AGCTGTTTAT TTAGTATTTA GTGAATTTTC AAGATTATGG TGGACTATCT
TCTCATATTC ATTGTGTCTC CAATGTCCAT ATCATCTCCA CTTTCTTGTA CGTTTATATG ATAACTACAT TATCTTTTGT
TTGAAGCAGA AGGAATGAAC TTGCACGAAC TGCTGCAAAT CAATTCCTCC AAGATTTGCA GAATGGGAGT TTAGACATGT
GAGATGCTCC TCCCCCCCCT CTCCTTCTCT CTCTCTATCT CCCTCTCTAT TTTACTTAAT TTTATTGGCC ACTCTGTGCA
GTGGTCCAGG ATTAACAAGT TCTGCAACAA ACAAATCTGG GAATAGCGTA GATGATACGG ATGCTAATGG AAAAAAGGGG
AAACTTGGAA AGAGCCAAGA TGATTTATAT TATGCTGCTC CTAAGGCTCA TCCAGTTAGC TCTGAGCCCC GTCGAATTAG
AATTGACGTT GAGCTAGCTC AAGCTCTCAT TTGTAAACTT GATTCAGAGA AGGGTATTGA GAATAATGTT CTGTCAGGTA
GTGATCATGA CAGAGCAGAG AAAGATAAGT CACATGGTTC AATGGGACCA ATCGTAATAA TACGGGGTTC ATCTGCTGTA
AAGGGTCTTG AGGGTGCTGA GTTGCTGGAC ACTCTTGTTA CCTATTTGTG GCGTATCCAT GGTGTGGATT ACTATGGGAT
GTCTGAGACA AATGAGCCCA AAGGTCTAAG GCATGTGAAA GCAGATTCAA GGACGTTTAA TGGGGCTAGC TCAAATGCAG
CTGAATGGGA GAAGAAACTT GATTCCTTCT GGCAAGATAG GATTCAAGGC CAGGATCCAA TGGAAATATT GAAAGCAAAG
GATAAGATTG ATGCAGCTGC TAGTGAAGTG CTGGATCCAC ATGTGAGAAA AATAAGGGAT GAAAAGTATG GATGGAAATA
TGGCTGTGGA GCTAAGGGCT GCACAAAACT TTTCCATGCC CCTGAGTTTG TCCAGAAGCA TCTCAAACTC AAACATGCGG
ATTTGGTTAG GGAACTGACT TCGAAAGTGA GAGAAAATAT TTATTTTGAT AACTATATGA GGTATGTTTT CTTCATTGTC
ATTCTTTTGG CTGAACTAAT TTTTAACATT CCAAAGAAGA TTATGCTGTA CATATTGCAT GCAGTGATCC CAAGGCACCT
GGTGGGATGC CTATCATGCA GCAACCTGCT CCAGTAAGCC TCACTACCTA GTTTTTAGTC AGTTGCAAAT TGGTGACTGT
TTAAGTTCCT TACTGTCTTG TTTGTATTGG CCAATTTTTC AGAGGGAGAA AGTCAGACAG CGGCCACCAA TAGAGAGTCG
GCTGAGAGAT GAGCGTGGCA ATCGTAGGTT TGATAGAAAT GATTCACCAA CCCATGATGG ATCCAGTGAC AACCCTGATG
ATGCATATGA TTCTTATGGT GATCCGGTTA TGCATGGCGC CTTTCCTCCG GATATTCCTG CTCCTCCAGT GTTGATGCCT
GTGCCTGGTG CTGGGTAAGT CTGCAACTTG TGCTTAGTTT TCACAATAAT ACACTTATTG TTGATTCGTT GTCATTTTCA
TCTCAGCCCA CTAGGACCAT TTATTCCTGC ACCACCTGAA GTTGCTATGC GTATGATGAG AGATCAGGGT GGACCACCAC
CTTTTGAGCC AACTGGTGGT CCACGTCCTA GGAGACCAGG GAGGGGTGGT CTTCCAATGG GTGGCCCATC ACCAATTCTT
GCTGCTCCTT TACCACCCCC TCATATGCAT GATCCACGCA AAATACGAAG GTTAGTACTT ACATGTTTGT CTCCTTTCCC
TTGTGTTCCC TATTCTGTCC TCACCATGCG ACATAAGCAA TTTATTTCAA TATCCTGAAA CATCGTTAAC AAAATAAGTA
TGCTGATAGT GAAAAAACTG AACACTGATT ATTTCTCTGG AGTTCTGCTG GACATCCTTT GTCGTAATTT ACCGTGATAT
GCAAATATTT CTTTAGAGAA AAGGCTGCAA TGACCTGGCT TGTATTGAAA GCCAAAAGGT TGTCTGCTGG GGATTCCAGC
TTTACATGTG TATCACAGGA AACCTAAACT GATTACACCC TGATCAAGTA GGTATCGCCC AGAGCCAAGC AAAAACTGAG
GTCTTAAACA ACCAGACTAC AGTACTAGGG ATATAACAAC TCCCAAAAAC AGAATCCCAG ACTACTGTAG CGAAGCTGGC
ACGGCATTTG ACCATGATAT GCAAATATCT CAAGTTCACT ACGAAATTTG GATGATCCGC TTGCAAATTT GAGCTCATTA
GCAGAACACG CGATTGATTT GGATTTCATA TACCTGGAAC AAACATGGCC ATGTCACAAT TCACAAAGGA CCTTACATAC
AGTTTGAAGC ATGGTAAAAC ATGCTCCTGG TATTGTTTGT AGAGTCTCTT GGCTAGGAAA TTTTTAAAAA ACTTATTAGG
ATAGGATGTC AAGTTGGTGT TTCCAATATA GTCTGATTTG TGCTTGCTAA AGCATTTGCA AGATGTACAA TACGTTATCA
TGGAGATTGT TTGTCAGATT TAAGGTATTG CTGTTCCCTG CTGCATGTAG GTTTGCGAAC TTTATGTTCT AACCAAAATT
TGTCCCCTAT ACATGTCTAC CAAGTTGTAT TTGAAGTTAG CACTGGCACA TCATATCTGA ACTTCAGAAT ACTCATTTGC
TGTTTATTTT AGATACTTAT TTTTTGCTAC AATTTTTCAC ATGTGTTAAC CTTGCTTCCA GCTATCAAGA CCTTGATGCT
CCTGAAGATG AAGTGACTGT TATGGACTAC CGAAGCTTGT AGAGGAATTG GAGACACGAT CCTTTTTTGT ATCTGGGAAA
CTGTAGGTAA TATTACAGAC CGCAACAAGA CGGCATTCAT TTCTAGATTT TTTTGTGAAC GCAAACAGGT AGGACTTTGA
GGTTCGGAGC TCTGTTACTG TCTGTAAAAT GGATCACAGG AAAACCTGGG ACAAGGAGCA TATTCTCATT CACCAATCAC
CACTCACCTG AAAAGAAAAC ATTGTGAAGT TTGTTCTTTG CAAAAAAGTT CCTAGCACTG TCCATTCCAA CCAAATGTCT
ACAAGCCTGC CATATCATCA GGTATTCGTA CCGTATTTGT ATATTCAGCT ACTGGGTGTG AGTAGATTGG AACCTGATAC
ATCGGCGTAT GCACAGACTT TCTATGAAGC CCGTTATGAA GAACATTTGT TCCCCATCTG CTAAGTTTGA GTTCAACCTT
GTCAGCTTGA AGAGTGTCCC AGTTCACCAG TCAGTATTGT ATCAGTTCTT GCCATTTGAT CAAGCTTAGT GTTGTCCCAT
TCCTTACCAT TGATGAAGCT TCTGTCAAAA TGGGAATATA TACACCTCGG ATGACTG

Locus: Os08g0517300

Loading...

Locus: Os08g0517300

Loading...