Os08t0520900-01

Locus

Os08g0520900

Description

Starch-debranching enzyme, Isoamylase 1, Amylopectin biosynthesis, Starch biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsPHS8, PHS8, ISA1, OsISA1

RAP-DB Gene Name Synonym(s)

pre-harvest sprouting 8, isoamylase1

CGSNL Gene Symbol

ISA1

CGSNL Gene Name

ISOAMYLASE 1

Oryzabase Gene Symbol Synonym(s)

OsISA1, ISA, OsISA, PHS8, PHS8/ISA1

Oryzabase Gene Name Synonym(s)

isoamylase 1, isoamylase1, sugary-1, pre-harvest sprouting 8

Transcript Evidence

AB015615 (Fujihikari truncated)

Inferred from literature

Protein Evidence

D0TZF0

Literature

PMID: 29775500

PMID: 28730411

PMID: 21436381

PMID: 12834068

PMID: 10333591

Note

Manual Curation

July 13, 2018

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Immunoglobulin-like fold (IPR013783)

Immunoglobulin E-set (IPR014756)

Glycoside hydrolase superfamily (IPR017853)

Glycosyl hydrolase, all-beta (IPR013780)

Glycoside hydrolase, family 13, N-terminal (IPR004193)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Expression Databases

TENOR (Os08t0520900-00)

RiceXPro (AB015615)

Others

Oryzabase (7056)

KEGG (Os08t0520900-00 (EC:3.2.1.68))

Transcript

2506 bp

>Os08t0520900-01 Starch-debranching enzyme, Isoamylase 1, Amylopectin biosynthesis, Starch biosynthesis
ATGGCGAGCCTCCCGCACTGCCTCTCCGCGCGCCCGCTCGTCGTCGCGGCGGCCCCGGGG
CGGCCTGGGCCGGGGCCGGGGCCGTGGCTGCGCGGCGGGGCGAGGCGGCGGAATGCGGCG
TTTTCGGCGGGGAACGCGGGGAGGCGGGTGGGGTTGAGGAGGTCGGTGGCCTCGGCGGTG
GAGGTCGGGGTCGGGGAGGATGAGGAGGAGGGTGTGGAGGAGGAGGAGGAGGAGGTGGAG
GCGGTGGTGATGCCGGAGAGGTACGCGCTGGGTGGCGCGTGCAGGGTGCTCGCCGGAATG
CCCGCGCCGCTCGGGGCCACCGCGCTCGACGGCGGGGTCAATTTCGCCGTCTACTCCGCC
GGCGCATCCGCCGCGTCGCTCTGCCTCTTCACCCCCGACGATCTCGAGGCGGATGAGGTG
ACTGAGGAGGTTCCGCTTGATCCTCTGTTCAATCGGACGGGGAATGTGTGGCACGTCTTC
ATCGAAGGCGAGCTGCACAACATGCTGTACGGGTACAGGTTCGATGGTATGTTCGCCCCT
CACTGCGGCCAGTACTTCGATGTCTCCAATGTCGTGGTGGATCCTTATGCCAAGGCAGTG
ATAAGCCGAGGAGAGTATGGTGTCCCCGGTCCTGGTGGCGATTGCTGGCCTCAAATGGCT
GGCATGATCCCTCTTCCGTACAGTACGTTTGATTGGCAAGGTGACCTACCTCTGAGATAT
CCTCAGAAGGATCTTGTAATCTATGAGATGCATTTACGTGGGTTTACAAAGCACAGTTCA
AGCAATGTAGAACATCCAGGGACTTACATTGGGGCTATATCAAAGCTTGACTATCTGAAG
GAGCTTGGAGTTAACTGTGTAGAGTTGATGCCCTGCCATGAATTCAATGAGCTGGAGTAC
TTCAGCTGCTCTTCCAAGATGAACTTCTGGGGATACTCCACGATAAACTTTTTTTCACCA
ATGATAAGATATTCATCAGGTGGGATAAGAAACTGTGGCCGTGATGCCATAAATGAATTC
AAAACTTTTGTTAGAGAGGCTCACAAACGGGGAATTGAGGTGATCATGGATGTTGTCTTC
AATCATACAGCCGAGGGTAATGAGAAAGGACCAATATTATCATTTAGGGGGATAGATAAT
AGCACATACTATATGCTTGCCCCTAAGGGAGAGTTTTACAATTATTCTGGTTGTGGGAAT
ACCTTCAACTGTAATCATCCTGTGGTCCGTGAATTTATTGTAGATTGTTTAAGATACTGG
GTGACAGAAATGCATGTTGATGGTTTTCGTTTTGATCTTGCATCCATAATGACCAGAGGA
TGCAGTCTTTGGGATCCAGTTAATGTGTATGGAAGTCCAGTAGAAGGTGACATGACTACG
ACAGGGACACCTCTTGCTACTCCACCACTTATTGACATGATCAGCAATGATCCAATTCTT
GGAGATGTCAAGCTCATTGCTGAAGCATGGGATGCGGGAGGCCTCTATCAAGTAGGTCAA
TTTCCTCACTGGAAAATTTGGTCAGAATGGAATGGAAAGTACCGGGACATTGTTCGTCAA
TTCATTAAAGGCACAGATGGATTTGCTGGTGGTTTCGCTGAATGTTTGTGTGGAAGTCCA
CATCTATACCAGGCAGGGGGGAGGAAACCTTGGCACAGTATCAACTTTGTGTGTGCGCAT
GATGGATTTACGCTGGCTGATTTGGTGACATATAACAAGAAGTACAACTCTTCAAATGGT
GAGGATAATAGAGATGGAGAAAATCATAACCTCAGCTGGAACTGTGGGGAGGAAGGAGAA
TTTGCAGGTTTGTCGGTCAAAAGATTGAGGAAGAGGCAAATGCGCAATTTCTTTGTTTCT
CTCATGGTTTCTCAAGGTGTTCCGATGTTCTACATGGGCGATGAATATGGCCATACAAAA
GGAGGCAACAACAACACATACTGCCATGACCATTATGTCAATTATTTCCGCTGGGACAAG
AAAGAAGAATCCTCTGACTTGCAACGGTTCTGCTCTCTTATGACCAAATTCCGCAAACAA
TGCGAGTCCCTTGGCCTCGCAGACTTCCCAACAGCTCAACGGTTGCATTGGCATGGCCAT
CAGCCTGGGAAACCTGACTGGTCTGAGACAAGCCGTTTCGTGGCCTTCTCCACGAAAGAT
GAAACGAAAGGCGAGATCTACGTGGCCTTCAACGCCAGCCATTTGCCGGCGGTTGTTGGA
CTCCCAGAGCGCCCAGGCTACCGCTGGGAGCCGCTGGTGGACACAGGCAAGCCAGCGCCT
TATGACTTCCTCACCGACGACCTGCCTGATCGTGCTCACGCCGTCCACCTGTTCTCTCAT
TTCCTCAACTCCAATCTCTACCCCATGCTCAGCTACTCCTCCATCATCCTTGAATTGCAG
CCTGATGATTGAAAGAACAAAGTATAGCATAGTATAGCAGAGTAAAAAACATATGTTTAT
AGCCCTTTTTGCGTATATGTTGAAGTTGTGCGGTCCTTCAATTTTG

CDS

2412 bp

>Os08t0520900-01 Starch-debranching enzyme, Isoamylase 1, Amylopectin biosynthesis, Starch biosynthesis
ATGGCGAGCCTCCCGCACTGCCTCTCCGCGCGCCCGCTCGTCGTCGCGGCGGCCCCGGGG
CGGCCTGGGCCGGGGCCGGGGCCGTGGCTGCGCGGCGGGGCGAGGCGGCGGAATGCGGCG
TTTTCGGCGGGGAACGCGGGGAGGCGGGTGGGGTTGAGGAGGTCGGTGGCCTCGGCGGTG
GAGGTCGGGGTCGGGGAGGATGAGGAGGAGGGTGTGGAGGAGGAGGAGGAGGAGGTGGAG
GCGGTGGTGATGCCGGAGAGGTACGCGCTGGGTGGCGCGTGCAGGGTGCTCGCCGGAATG
CCCGCGCCGCTCGGGGCCACCGCGCTCGACGGCGGGGTCAATTTCGCCGTCTACTCCGCC
GGCGCATCCGCCGCGTCGCTCTGCCTCTTCACCCCCGACGATCTCGAGGCGGATGAGGTG
ACTGAGGAGGTTCCGCTTGATCCTCTGTTCAATCGGACGGGGAATGTGTGGCACGTCTTC
ATCGAAGGCGAGCTGCACAACATGCTGTACGGGTACAGGTTCGATGGTATGTTCGCCCCT
CACTGCGGCCAGTACTTCGATGTCTCCAATGTCGTGGTGGATCCTTATGCCAAGGCAGTG
ATAAGCCGAGGAGAGTATGGTGTCCCCGGTCCTGGTGGCGATTGCTGGCCTCAAATGGCT
GGCATGATCCCTCTTCCGTACAGTACGTTTGATTGGCAAGGTGACCTACCTCTGAGATAT
CCTCAGAAGGATCTTGTAATCTATGAGATGCATTTACGTGGGTTTACAAAGCACAGTTCA
AGCAATGTAGAACATCCAGGGACTTACATTGGGGCTATATCAAAGCTTGACTATCTGAAG
GAGCTTGGAGTTAACTGTGTAGAGTTGATGCCCTGCCATGAATTCAATGAGCTGGAGTAC
TTCAGCTGCTCTTCCAAGATGAACTTCTGGGGATACTCCACGATAAACTTTTTTTCACCA
ATGATAAGATATTCATCAGGTGGGATAAGAAACTGTGGCCGTGATGCCATAAATGAATTC
AAAACTTTTGTTAGAGAGGCTCACAAACGGGGAATTGAGGTGATCATGGATGTTGTCTTC
AATCATACAGCCGAGGGTAATGAGAAAGGACCAATATTATCATTTAGGGGGATAGATAAT
AGCACATACTATATGCTTGCCCCTAAGGGAGAGTTTTACAATTATTCTGGTTGTGGGAAT
ACCTTCAACTGTAATCATCCTGTGGTCCGTGAATTTATTGTAGATTGTTTAAGATACTGG
GTGACAGAAATGCATGTTGATGGTTTTCGTTTTGATCTTGCATCCATAATGACCAGAGGA
TGCAGTCTTTGGGATCCAGTTAATGTGTATGGAAGTCCAGTAGAAGGTGACATGACTACG
ACAGGGACACCTCTTGCTACTCCACCACTTATTGACATGATCAGCAATGATCCAATTCTT
GGAGATGTCAAGCTCATTGCTGAAGCATGGGATGCGGGAGGCCTCTATCAAGTAGGTCAA
TTTCCTCACTGGAAAATTTGGTCAGAATGGAATGGAAAGTACCGGGACATTGTTCGTCAA
TTCATTAAAGGCACAGATGGATTTGCTGGTGGTTTCGCTGAATGTTTGTGTGGAAGTCCA
CATCTATACCAGGCAGGGGGGAGGAAACCTTGGCACAGTATCAACTTTGTGTGTGCGCAT
GATGGATTTACGCTGGCTGATTTGGTGACATATAACAAGAAGTACAACTCTTCAAATGGT
GAGGATAATAGAGATGGAGAAAATCATAACCTCAGCTGGAACTGTGGGGAGGAAGGAGAA
TTTGCAGGTTTGTCGGTCAAAAGATTGAGGAAGAGGCAAATGCGCAATTTCTTTGTTTCT
CTCATGGTTTCTCAAGGTGTTCCGATGTTCTACATGGGCGATGAATATGGCCATACAAAA
GGAGGCAACAACAACACATACTGCCATGACCATTATGTCAATTATTTCCGCTGGGACAAG
AAAGAAGAATCCTCTGACTTGCAACGGTTCTGCTCTCTTATGACCAAATTCCGCAAACAA
TGCGAGTCCCTTGGCCTCGCAGACTTCCCAACAGCTCAACGGTTGCATTGGCATGGCCAT
CAGCCTGGGAAACCTGACTGGTCTGAGACAAGCCGTTTCGTGGCCTTCTCCACGAAAGAT
GAAACGAAAGGCGAGATCTACGTGGCCTTCAACGCCAGCCATTTGCCGGCGGTTGTTGGA
CTCCCAGAGCGCCCAGGCTACCGCTGGGAGCCGCTGGTGGACACAGGCAAGCCAGCGCCT
TATGACTTCCTCACCGACGACCTGCCTGATCGTGCTCACGCCGTCCACCTGTTCTCTCAT
TTCCTCAACTCCAATCTCTACCCCATGCTCAGCTACTCCTCCATCATCCTTGAATTGCAG
CCTGATGATTGA

Protein

804 aa

>Os08t0520900-01 Starch-debranching enzyme, Isoamylase 1, Amylopectin biosynthesis, Starch biosynthesis
MASLPHCLSARPLVVAAAPGRPGPGPGPWLRGGARRRNAAFSAGNAGRRVGLRRSVASAV
EVGVGEDEEEGVEEEEEEVEAVVMPERYALGGACRVLAGMPAPLGATALDGGVNFAVYSA
GASAASLCLFTPDDLEADEVTEEVPLDPLFNRTGNVWHVFIEGELHNMLYGYRFDGMFAP
HCGQYFDVSNVVVDPYAKAVISRGEYGVPGPGGDCWPQMAGMIPLPYSTFDWQGDLPLRY
PQKDLVIYEMHLRGFTKHSSSNVEHPGTYIGAISKLDYLKELGVNCVELMPCHEFNELEY
FSCSSKMNFWGYSTINFFSPMIRYSSGGIRNCGRDAINEFKTFVREAHKRGIEVIMDVVF
NHTAEGNEKGPILSFRGIDNSTYYMLAPKGEFYNYSGCGNTFNCNHPVVREFIVDCLRYW
VTEMHVDGFRFDLASIMTRGCSLWDPVNVYGSPVEGDMTTTGTPLATPPLIDMISNDPIL
GDVKLIAEAWDAGGLYQVGQFPHWKIWSEWNGKYRDIVRQFIKGTDGFAGGFAECLCGSP
HLYQAGGRKPWHSINFVCAHDGFTLADLVTYNKKYNSSNGEDNRDGENHNLSWNCGEEGE
FAGLSVKRLRKRQMRNFFVSLMVSQGVPMFYMGDEYGHTKGGNNNTYCHDHYVNYFRWDK
KEESSDLQRFCSLMTKFRKQCESLGLADFPTAQRLHWHGHQPGKPDWSETSRFVAFSTKD
ETKGEIYVAFNASHLPAVVGLPERPGYRWEPLVDTGKPAPYDFLTDDLPDRAHAVHLFSH
FLNSNLYPMLSYSSIILELQPDD*

CDS

chr08:25900166..25900576 (- strand) : 411 bp

chr08:25899850..25900032 (- strand) : 183 bp

chr08:25899653..25899745 (- strand) : 93 bp

chr08:25899144..25899296 (- strand) : 153 bp

chr08:25898674..25898750 (- strand) : 77 bp

chr08:25897951..25898092 (- strand) : 142 bp

chr08:25897761..25897868 (- strand) : 108 bp

chr08:25897561..25897646 (- strand) : 86 bp

chr08:25897091..25897162 (- strand) : 72 bp

chr08:25896876..25897002 (- strand) : 127 bp

chr08:25896436..25896522 (- strand) : 87 bp

chr08:25895902..25895994 (- strand) : 93 bp

chr08:25895255..25895413 (- strand) : 159 bp

chr08:25894735..25894818 (- strand) : 84 bp

chr08:25894500..25894580 (- strand) : 81 bp

chr08:25894340..25894419 (- strand) : 80 bp

chr08:25894129..25894246 (- strand) : 118 bp

chr08:25893751..25894008 (- strand) : 258 bp

3'UTR

chr08:25893657..25893750 (- strand) : 94 bp

FASTA

>Os08t0520900-01 class=Sequence position=chr08:25893657..25900576 (- strand)
ATGGCGAGCC TCCCGCACTG CCTCTCCGCG CGCCCGCTCG TCGTCGCGGC GGCCCCGGGG CGGCCTGGGC CGGGGCCGGG
GCCGTGGCTG CGCGGCGGGG CGAGGCGGCG GAATGCGGCG TTTTCGGCGG GGAACGCGGG GAGGCGGGTG GGGTTGAGGA
GGTCGGTGGC CTCGGCGGTG GAGGTCGGGG TCGGGGAGGA TGAGGAGGAG GGTGTGGAGG AGGAGGAGGA GGAGGTGGAG
GCGGTGGTGA TGCCGGAGAG GTACGCGCTG GGTGGCGCGT GCAGGGTGCT CGCCGGAATG CCCGCGCCGC TCGGGGCCAC
CGCGCTCGAC GGCGGGGTCA ATTTCGCCGT CTACTCCGCC GGCGCATCCG CCGCGTCGCT CTGCCTCTTC ACCCCCGACG
ATCTCGAGGC GGTGAGCTCG CTTCAGACCA CCACAACGGT GTCACGCGTT CCTCGCGAAG TTCTCCTTTC GTTTTCAGTG
GCTCTGTTTT TTTTTTAATC CGATGATTAG TTGAGGTGGT TTTGCATTGT GTGGGATGGT GCAGGATGAG GTGACTGAGG
AGGTTCCGCT TGATCCTCTG TTCAATCGGA CGGGGAATGT GTGGCACGTC TTCATCGAAG GCGAGCTGCA CAACATGCTG
TACGGGTACA GGTTCGATGG TATGTTCGCC CCTCACTGCG GCCAGTACTT CGATGTCTCC AATGTCGTGG TGGATCCTTA
TGCCAAGGTG ATGCATTAGC TTCATTTTGC CTTCTTGGTG TTCTTCTCCT ATGTTTGTGA TTGTACTAGT TTTGGGAGGC
GCTTATCTGC AGTTTTTTTC TATTACTGTA GGCAGTGATA AGCCGAGGAG AGTATGGTGT CCCCGGTCCT GGTGGCGATT
GCTGGCCTCA AATGGCTGGC ATGATCCCTC TTCCGTACAG TACGGTATGC CAACGAATCA GTTTCCTTTT TTTTTTAACT
CCCACTTGTT TCCATTTATC CTCTTTTGAT CTGATACCCG ACTACCCGAG GCAGTCATTA TCCGATTATC TGGTTGCTGA
ATGTACAACT AAGATTTGCA TCTTTTTTTC TAATATTGTA ATTTTGATAA TAATAATAAT AATATTTGTT TGCAAGTGGA
AAAGAACATG ATTTTTTTTT TTCCGAAGGA ATTCCATTTA TTCGTTGCTG CTATGAAGTG GAATTGCATT TATGTGCCTT
GTAAAAAAAT GAATTGCATT AATTTGTTGT TGTTACTGTC TATGATATTA AATCTCACAG TAAAATGTTT GCATTTGCAG
TTTGATTGGC AAGGTGACCT ACCTCTGAGA TATCCTCAGA AGGATCTTGT AATCTATGAG ATGCATTTAC GTGGGTTTAC
AAAGCACAGT TCAAGCAATG TAGAACATCC AGGGACTTAC ATTGGGGCTA TATCAAAGCT TGACTATCTG AAGGTGCATT
TTACTAATTA CCTAGTTCGG TCAAGAAGCT ATTGGGCCAC AGAGCAATTT ATAAGACTGT TACATATTCA TTTTTTATAA
GATCTTCACG TACATCTAGA TTTTGCATGG CTTTTGCTGA AGATATCCTA TTCTACAACT TAACCATAAT CAAGTATTTC
TAAGACCTTC CCGGCGAAAA AAAGTATTTC TAAGACCTAT GCTGTACTTT GTGATAGAAC ACTTAAAATT TGGTCTATGC
ATTGACAAAT TTACTTAGTG TCCCAGCATT TTTTTTCTTA TTTTGTTCAT GAGTGGTCCA TTAAGTGAAT AGCTGTAATA
ATAGCCTGTT TATATTTTTA GTTGTGTGTT TATTCTTAAT TTAAATCTGG AATAACCCCT CTACAGGAGC TTGGAGTTAA
CTGTGTAGAG TTGATGCCCT GCCATGAATT CAATGAGCTG GAGTACTTCA GCTGCTCTTC CAAGTATGCA GACTTACATC
CAGAATTGAG CTATAAGCAG TGTTTGAATG GGGCCTAACG AATCTTACTC TCGCAAAACT GATTTCCCCC TTCTAAACTG
TGCATTGGTT AACATCCAGT CAACTATTTT GCATAAGGTG TTTGTGTAGA CATGATAGAT ATGACCTACT GCTAACGCTA
CCATCTTGAC TTTTATAAGT TGATAAAATA AACTAGTTTT TCTTTGTGAG ATGTAAACAA TAATTAATGT TGGTCACATC
AATATCGTAT TACATTTGAA TAATTGATAG CCCAAATCTC CCACTCTTAT AAGAGGTTCC ACATGCATAG ATTTTGCATA
GTTGCAGCAT AACAGCCTTT TCTTTGTCTA GATTCTTGAA TGTGATTTTT TTTTCCATCT CTAAACTCAG TTTACCTTTT
TCCCTTCATT TGCATGGAAT GTTGCAGTTA CGCACTTACT TTCTTGTAAC ATGTGTACTG TGTACATCCA TACATGTTTT
TACATTATTA TGATTTTTCA TATTTTCATA GAAATTCAAT CATTTTTTAT ATTATTTCAT ATAAACTGCT CACTATCTTA
CCAGGATGAA CTTCTGGGGA TACTCCACGA TAAACTTTTT TTCACCAATG ATAAGATATT CATCAGGTGG GATAAGAAAC
TGTGGCCGTG ATGCCATAAA TGAATTCAAA ACTTTTGTTA GAGAGGCTCA CAAACGGGGA ATTGAGGTAA CCAAGTTGAT
ATAGCTAATT CTTGTTTAGT AATTGCTGCT TTCTCAACAT ATTTTTTTAC GTGGGGATAC TCTATTAGGT GATCATGGAT
GTTGTCTTCA ATCATACAGC CGAGGGTAAT GAGAAAGGAC CAATATTATC ATTTAGGGGG ATAGATAATA GCACATACTA
TATGCTTGCC CCTAAGGTGC GTTATATTGC TCATTGTGGA AACATTTCTT TTTTTTTCTT CAGAGATGTA TATAATGCAG
TTTTATTATG TAATTCTATC TAAGAATTTG AAGGGTGTTT GTGCCTACAG GGAGAGTTTT ACAATTATTC TGGTTGTGGG
AATACCTTCA ACTGTAATCA TCCTGTGGTC CGTGAATTTA TTGTAGATTG TTTAAGGTAC AGTTATAAAT ATATATATAT
ACTGCACAGT AAAACAGTTA TTGATCTCTT CTCACTGCTT ATCATTTTGT CAAGAACTTC AATTGCAAGC CTGTAAGGGT
TTTATTCTTT TAATCTCCAG CAAATTGCTT TTTTCTGTTT TCAAAACACA TACTGATGAT GTTTCAGTGC TTGAGTATAT
GTACACTTGG ATATTCTTCT ATATTCTAAT AAAGCAGGGA AACTATATCC CATCATCTTA TCATTTTTTT ATGCTCATTA
ATAATAAATA AATCAAAGAA CTGCCATGTT TGTTGTAATA TGCTTGAATC TCCTGTTAGG CCATTTTTCA TGATATCTTT
GGTGTGCTTA TTTTTGTTTG CTTTATTCTA AACAAAATAG CTTTGACATT GCAGATACTG GGTGACAGAA ATGCATGTTG
ATGGTTTTCG TTTTGATCTT GCATCCATAA TGACCAGAGG ATGCAGGTAA ACGGCAGTTC ATTTATTTTA TTTTATTTTG
GCCGTGTTTT GTCTTTCCAG AAGAGTCTTA TTTTTTTCCT GTTACTTTTA CAAGTCTTTG GGATCCAGTT AATGTGTATG
GAAGTCCAGT AGAAGGTGAC ATGACTACGA CAGGGACACC TCTTGCTACT CCACCACTTA TTGACATGAT CAGCAATGAT
CCAATTCTTG GAGATGTCAA GGTTACTACT TTTTCTGACT TTTGTTGCGC ATCTACAATT TCTAGTACAT TCATACCAGT
AATGTTACCA TTCATATTTT TGGCAATGAA TTTATTTTTC TACACAAGTA ATTCTTTTGT TCTGATATAA AGAAAATATC
TACACCAAAT ATCATAATAG TATGtactac ctctgtttca tattataagt cgttttgact tttttatatg tcaaatttct
ttaggtttga tcaaatttat agacaaaaaa gtcaaaaggg acttataata tcaaatGGAG GGAGTATGAT ATAATTAGCA
CGTTGTTGTA TCCTTGTGAA ATCCTCTTAT TCGTATATCC GGTTGCATTT ATAGCTCATT GCTGAAGCAT GGGATGCGGG
AGGCCTCTAT CAAGTAGGTC AATTTCCTCA CTGGAAAATT TGGTCAGAAT GGAATGGAAA GGTAACAACT GCATATCTTG
ATCTATTCGA TTTTCTAAGG AAACAAATGT TTCCTTGCAT ACACTAAATA GAGGTTATAT ATGAGACATG TCTAATTTAA
CATAACATTA TTTTACTAAA CTTCAAAGGC AAACACATAA ATTATTCTGC CCATAAATGT ACACAGAAGA TAATACATGA
ACTGAACGGT GAGCTATTTC TCAGGGCTAC TGCTAACAAT ACATAAATAC GCCTTTTGTT CTTTAGCAGG GCATGGGTTA
TGAAAAAGTA AGAAACAACA GTATACTAAG CTTATATTTG AGCTAGACAC TGAACTTTGG AGTTATAACA TATGATCTGC
ATCCATCTAA AGTTAAACCA ACATCTAACA TAGTTCCCAC TTTATATGTG TAATTGTTGT TTTATCATAG CACTGACTTA
TATTATGTGC TTGTTTCTCC AGTACCGGGA CATTGTTCGT CAATTCATTA AAGGCACAGA TGGATTTGCT GGTGGTTTCG
CTGAATGTTT GTGTGGAAGT CCACATCTAT ACCAGGTACA TAGTGAAATA CCTTTAGATG GATCGGGTAC AATGCAAATT
GGATGGGGTC TTTGGAAATG CCACACGATG AACTGGTGAT AATAGTGCAT GAAGCTTACA GTTATAATTC TAGATCCACG
CATAGCCTTT AACACACGAC TTGCGAGTAA AGAAAATGGT CTTGTTTTCT TTTCATTCAT TTTTTGGGGT GCTCTTGTGT
CTGGTGAGGC TTCTATTTGG CCTAACCTCT GAAAAAATAA CCTCCATGCC ATTTTTATTT TCTTTTGTCC ATTTCTCTTT
GTGAAAAGAG GTTATGTTAG ATACTGATAG CCAATTGGAC TAGTACATTT CTGACACTTA AAAATACACA GAGAAGTACC
AATGCAAAGT AGCTTCATTC TAGTCTATGT AATTTGTTTT TTACTTCACA TTTCCTTTAG GTTTGCATAA GAATCAAAGC
TGTCACTTGT ATTTGCCATT ACAAATATTC CTTTATTAAT CAGGCAGGGG GGAGGAAACC TTGGCACAGT ATCAACTTTG
TGTGTGCGCA TGATGGATTT ACGCTGGCTG ATTTGGTGAC ATATAACAAG AAGTACAACT CTTCAAATGG TGAGGATAAT
AGAGATGGAG AAAATCATAA CCTCAGCTGG AACTGTGGGG AGGTAATACT GCACTATAAT GTTTATGCAT AGTTCTTGTT
TTACTTCTAT TCAAATGCCC GATAATCTTA CAATGGCTTT ACTCGATAGC TAAACCATTA GTGTGATGAA GGTTTCCCCT
ACCAAATATC ATGGTCTGTA AACTTCCTGT ATTTCTTAAA GATGAAAATG TGTGTTGTAT TTTGTAAATG AGATGAGTTA
TGGGACTTAT GGATGAAGGT TACTACTGGT GGTAGGTAAA CCATGAGTCC AGTCACTAGG ATTTGATGCT GGTGGGAAAA
CCATGTGAGC TCAGTGACTA GGATTTGCGC TCCGTTTGCC TCACCAGAGG CGCAGACCTG ATATACATTA GCAATTTCAA
AGTAATTAGT TTTCTTTCAA TTTGCAGTTG AGAATCTTAT ATAGAATGCG CATTTACAAT TTCATGTCAA CAATGTAGGA
AGGAGAATTT GCAGGTTTGT CGGTCAAAAG ATTGAGGAAG AGGCAAATGC GCAATTTCTT TGTTTCTCTC ATGGTTTCTC
AAGTAAGATT TATTATCTGA CCTCTTTAAT TATCTTAGAC CGTTTGCCAA AATGTAGGAT GACGTTAAGA TGCTAGTTCT
GTACTTGCCA CTTTCATTAG TCACATCTTC TGCAGTATTT AACATTTTAA ACTATTACTT TCTCTTAATT CTTTAGGGTG
TTCCGATGTT CTACATGGGC GATGAATATG GCCATACAAA AGGAGGCAAC AACAACACAT ACTGCCATGA CCATTATGTC
AGTCCAATGT GATGGTGTAT TTTTCGAATC AGCTGTCATT AAACCCCTCC CTTAATCCAT CTTTGGTTCT TCTATAGGTC
AATTATTTCC GCTGGGACAA GAAAGAAGAA TCCTCTGACT TGCAACGGTT CTGCTCTCTT ATGACCAAAT TCCGCAAGTA
ACTACTCTGG AACACTTCCA CATGCTAAAC AAGTGAGACC GTCTCCATAG CCTACATCGA CCTCATGCTT TGTTTTCTTT
TACATTGCAG ACAATGCGAG TCCCTTGGCC TCGCAGACTT CCCAACAGCT CAACGGTTGC ATTGGCATGG CCATCAGCCT
GGGAAACCTG ACTGGTCTGA GACAAGCCGT TTCGTGGCCT TCTCCACGGT ACCTACATAA TGCTCTCACA CAACACAGCC
ATTTCCCCCA AAAAATAAAA GCACCGTCTT TTTCACAACA ATCAAGTTGA AGCTAGATGA TAATTTCTTT TATCCATGTC
TATCACAGAA AGATGAAACG AAAGGCGAGA TCTACGTGGC CTTCAACGCC AGCCATTTGC CGGCGGTTGT TGGACTCCCA
GAGCGCCCAG GCTACCGCTG GGAGCCGCTG GTGGACACAG GCAAGCCAGC GCCTTATGAC TTCCTCACCG ACGACCTGCC
TGATCGTGCT CACGCCGTCC ACCTGTTCTC TCATTTCCTC AACTCCAATC TCTACCCCAT GCTCAGCTAC TCCTCCATCA
TCCTTGAATT GCAGCCTGAT GATTGAAAGA ACAAAGTATA GCATAGTATA GCAGAGTAAA AAACATATGT TTATAGCCCT
TTTTGCGTAT ATGTTGAAGT TGTGCGGTCC TTCAATTTTG