Os08t0521600-01

Locus

Os08g0521600

Description

AP2/EREBP family transcription factor, Tolerance to heat and drought stress

RAP-DB Gene Symbol Synonym(s)

OsERF115/AP2EREBP110

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERF115

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 115

Oryzabase Gene Symbol Synonym(s)

OsERF#115, OsERF115, AP2/EREBP#110, AP2/EREBP110, OsEnS-123

Oryzabase Gene Name Synonym(s)

ethylene response factor 115, APETALA2/ethylene-responsive element binding protein 110, endosperm-specific gene 123

Transcript Evidence

AK108208

Protein Evidence

Q84QR5

Literature

PMID: 34281241

Note

Manual Curation

July 26, 2021

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

DNA-binding domain superfamily (IPR016177)

AP2/ERF domain superfamily (IPR036955)

AP2/ERF domain (IPR001471)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-140-D07 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0521600-01)

RiceXPro (AK108208)

Others

Oryzabase (10611)

KEGG (Os08t0521600-01)

Transcript

900 bp

>Os08t0521600-01 AP2/EREBP family transcription factor, Tolerance to heat and drought stress
ACCATCTCCTCCTCGTCATCGTCATCGTCTTCCTCCTCGCGTCGCCGATCACCTCGCCAT
GGTGCCGCCGGCGGCGCACGCGCCGAAGAACCTGGGGCTGAGGggggtgcggcgccggct
gtggggcaggtgggcggcggagatccgcgtgccgcggggccaccgcgcggccgcgaggct
gtggatcggcacgttcccgtccccggcggcggcggcgctcgcctacgacgccgcgctcta
ctgcttccacggcggcgcgccgccggggaaccgcgccttcaacttcccgCACGCGCCGCG
CCTCCGCATCGACGACCGCCGCCGCCACGCGCTCACGCCGGGCCACGTCAGGGCCATCGC
CGAGAGGTACGCCCACGACGTCGGCTCCGTCCTGTTCCGCCCGCTCCCTCCGCCGCCGCC
GCCCGTCGCCGCCGCCGCCGTCCCCGTGTTCGCCGCACCTGCACCGCCCATGGCGCCGGC
GCCGGCCAACCATGCTGCCGATCCTTACTACTGCAACGAGCCTGACACCACCACAGACGA
GGACGTCATGGCTGCGGCTGACCGCCTCCTCTCCATGGACATCGAAGAGGTCGCCGCTTT
GATCGCCATTGTTCAGCAAGGAGAGTGACCATATCTACAACTTCTTAGCTAGCTAGTTAC
ACCTTCTATGTAGCATGTGTACTATGCACTTTTGTGGTTGTGTTGTGCTGTCCTAATGGT
GTAACTAGCCATATCAAGGAAGACATGCATGATCTAGAGTCTAGAGTACTCTAGCCATGG
AATAAATTAACTTAGTCTGTACTTGGTCATGCACCTTGTGTATGATCCTTGTGTAAGAGA
AGTGTAATAATCGGTTCTTGAAAAGGAACTGTTGTTATATATGAGATGGATGTTGTCATG

CDS

570 bp

>Os08t0521600-01 AP2/EREBP family transcription factor, Tolerance to heat and drought stress
ATGGTGCCGCCGGCGGCGCACGCGCCGAAGAACCTGGGGCTGAGGggggtgcggcgccgg
ctgtggggcaggtgggcggcggagatccgcgtgccgcggggccaccgcgcggccgcgagg
ctgtggatcggcacgttcccgtccccggcggcggcggcgctcgcctacgacgccgcgctc
tactgcttccacggcggcgcgccgccggggaaccgcgccttcaacttcccgCACGCGCCG
CGCCTCCGCATCGACGACCGCCGCCGCCACGCGCTCACGCCGGGCCACGTCAGGGCCATC
GCCGAGAGGTACGCCCACGACGTCGGCTCCGTCCTGTTCCGCCCGCTCCCTCCGCCGCCG
CCGCCCGTCGCCGCCGCCGCCGTCCCCGTGTTCGCCGCACCTGCACCGCCCATGGCGCCG
GCGCCGGCCAACCATGCTGCCGATCCTTACTACTGCAACGAGCCTGACACCACCACAGAC
GAGGACGTCATGGCTGCGGCTGACCGCCTCCTCTCCATGGACATCGAAGAGGTCGCCGCT
TTGATCGCCATTGTTCAGCAAGGAGAGTGA

Protein

189 aa

>Os08t0521600-01 AP2/EREBP family transcription factor, Tolerance to heat and drought stress
MVPPAAHAPKNLGLRGVRRRLWGRWAAEIRVPRGHRAAARLWIGTFPSPAAAALAYDAAL
YCFHGGAPPGNRAFNFPHAPRLRIDDRRRHALTPGHVRAIAERYAHDVGSVLFRPLPPPP
PPVAAAAVPVFAAPAPPMAPAPANHAADPYYCNEPDTTTDEDVMAAADRLLSMDIEEVAA
LIAIVQQGE*

5'UTR

chr08:25950258..25950315 (+ strand) : 58 bp

CDS

chr08:25950316..25950885 (+ strand) : 570 bp

3'UTR

chr08:25950886..25951157 (+ strand) : 272 bp

FASTA

>Os08t0521600-01 class=Sequence position=chr08:25950258..25951157 (+ strand)
ACCATCTCCT CCTCGTCATC GTCATCGTCT TCCTCCTCGC GTCGCCGATC ACCTCGCCAT GGTGCCGCCG GCGGCGCACG
CGCCGAAGAA CCTGGGGCTG AGGggggtgc ggcgccggct gtggggcagg tgggcggcgg agatccgcgt gccgcggggc
caccgcgcgg ccgcgaggct gtggatcggc acgttcccgt ccccggcggc ggcggcgctc gcctacgacg ccgcgctcta
ctgcttccac ggcggcgcgc cgccggggaa ccgcgccttc aacttcccgC ACGCGCCGCG CCTCCGCATC GACGACCGCC
GCCGCCACGC GCTCACGCCG GGCCACGTCA GGGCCATCGC CGAGAGGTAC GCCCACGACG TCGGCTCCGT CCTGTTCCGC
CCGCTCCCTC CGCCGCCGCC GCCCGTCGCC GCCGCCGCCG TCCCCGTGTT CGCCGCACCT GCACCGCCCA TGGCGCCGGC
GCCGGCCAAC CATGCTGCCG ATCCTTACTA CTGCAACGAG CCTGACACCA CCACAGACGA GGACGTCATG GCTGCGGCTG
ACCGCCTCCT CTCCATGGAC ATCGAAGAGG TCGCCGCTTT GATCGCCATT GTTCAGCAAG GAGAGTGACC ATATCTACAA
CTTCTTAGCT AGCTAGTTAC ACCTTCTATG TAGCATGTGT ACTATGCACT TTTGTGGTTG TGTTGTGCTG TCCTAATGGT
GTAACTAGCC ATATCAAGGA AGACATGCAT GATCTAGAGT CTAGAGTACT CTAGCCATGG AATAAATTAA CTTAGTCTGT
ACTTGGTCAT GCACCTTGTG TATGATCCTT GTGTAAGAGA AGTGTAATAA TCGGTTCTTG AAAAGGAACT GTTGTTATAT
ATGAGATGGA TGTTGTCATG 

Locus: Os08g0521600

Loading...

Locus: Os08g0521600

Loading...