Os08t0531600-01

Locus

Os08g0531600

Description

Transcription factor, Positive regulator of cell proliferation, Control of grain size, shape and quality

RAP-DB Gene Symbol Synonym(s)

GW8, SPL16, OsSPL16, SLP1, qGW8

RAP-DB Gene Name Synonym(s)

GRAIN-WIDTH 8, Squamosa promoter-binding-like protein 16, SQUAMOSA promoter-binding-like 16, stunted lemma palea 1, grain-width 8

CGSNL Gene Symbol

GW8

CGSNL Gene Name

GRAIN-WIDTH 8

Oryzabase Gene Symbol Synonym(s)

SPL16, OsSPL16, SLP1, qGW8

Oryzabase Gene Name Synonym(s)

Squamosa promoter-binding-like protein 16, SQUAMOSA promoter-binding-like 16, stunted lemma palea 1, grain-width 8

Transcript Evidence

AK109469

Protein Evidence

Q6YZE8

Literature

PMID: 22729225

PMID: 16861571

Note

Manual Curation

February 19, 2015

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

001-128-D02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0531600-01)

Others

Oryzabase (6900)

KEGG (Os08t0531600-01)

Transcript

1688 bp

>Os08t0531600-01 Transcription factor, Positive regulator of cell proliferation, Control of grain size, shape and quality
ACAGCTCAAGCTTACGCGGGAGCTAAGCTGAGCTACAGCGAGCGGCGGCGGCGGCCATGG
AGTGGGATCTCAAGATGCCGCCGGCGGCGAGCTGGGAGCTAGCCGACGAGCTGGAGAACA
GCGGCGGCGGGGGTGTACCGGCGGCGGTATCGTCGTCATCGGCTGCGGTTGGTGGCGGCG
TCAATGCGGGGGGTGGTGGCAGGCAGGAGTGCTCGGTCGACCTCAAGCTCGGCGGGTTGG
GGGAGTTCGGCGGCGGCGGCGCGCAGCCGCGGGTCGCCGTGGCGGGCGAGCCGGCCAAGG
GGAAGGGGCCAGCGGCCGCCGCCACGGGAGCAGCAGCAGCAGCGTCGTCGGCGCCGGCGA
AGCGGCCGCGCGGTGCGGCGGCGGCGGGGCAGCAGCAGTGCCCGTCGTGCGCGGTGGACG
GGTGCAAGGAGGACCTGAGCAAGTGCCGCGACTACCATCGCCGGCACAAGGTGTGCGAGG
CCCACTCCAAGACCCCCCTCGTCGTCGTCTCCGGCCGCGAGATGCGCTTCTGCCAGCAGT
GCAGCAGGTTTCACTTGCTTCAGGAGTTTGATGAGGCCAAGCGCAGCTGTAGAAAGCGAC
TAGATGGGCACAACCGTCGCCGCAGGAAGCCACAGCCAGATCCCATGAACTCTGCAAGTT
ATCTTGCAAGCCAACAAGGGGCAAGATTCTCACCGTTCGCGACGCCGAGACCGGAGGCAA
GCTGGACAGGGATGATCAAAACCGAGGAGAGCCCATACTACACGCACCACCAAATCCCTC
TTGGCATCAGCAGCAGGCAGCAGCATTTCGTTGGCTCCACCTCTGACGGCGGCCGCCGCT
TCCCTTTCCTCCAGGAAGGCGAGATCAGCTTCGGCACCGGCGCCGGCGCCGGCGGCGTGC
CAATGGATCAGGCAGCAGCTGCTGCTGCTGCTTCAGTGTGCCAGCCACTTCTGAAGACGG
TAGCTCCTCCTCCTCCTCCTCATGGCGGCGGCGGCAGCGGCGGCGGCAAGATGTTCTCCG
ATGGTGGGTTGACACAAGTGCTCGACTCCGATTGTGCTCTCTCTCTTCTGTCAGCTCCGG
CGAACTCCACGGCCATCGACGTCGGCGGTGGCCGGGTGGTCGTCCAGCCGACCGAGCACA
TCCCCATGGCGCAGCCTCTCATCTCTGGCCTTCAGTTCGGCGGCGGCGGCGGCAGCTCAG
CCTGGTTCGCGGCGCGGCCGCATCATCAGGCGGCCACCGGCGCCGCCGCCACCGCCGTCG
TCGTCTCGACGGCCGGTTTCTCCTGCCCGGTGGTGGAGAGCGAGCAGCTGAACACAGTCC
TGAGCTCCAATGACAATGAGATGAACTACAATGGGATGTTTCACGTCGGCGGCGAAGGCT
CATCGGATGGCACGTCGTCGTCTCTGCCGTTCTCATGGCAGTAGTTTTTTCAGTAACTGT
ATGTTGCTGCCTTAGTTTCAGTAGAGTTGGTTCTTCATTTCTTTTCAGTGATCAAATTAT
TGTTTCTGTTCTTTTCTGCCATGGTAAGTTCCTTTTTTTTTTCTTCTTCTTGCCTTCATT
TGAGTTAATTACAGCATTGATTTGTGTGAACAAAATTCATCATAAATCAGTTCCTCGCGA
GATCATTGGTCTCAACATGATGGTGCCAAGTGAGAACTGCAGTATTGTGCAGTTTTCAGT
TTTGAGTC

CDS

1368 bp

>Os08t0531600-01 Transcription factor, Positive regulator of cell proliferation, Control of grain size, shape and quality
ATGGAGTGGGATCTCAAGATGCCGCCGGCGGCGAGCTGGGAGCTAGCCGACGAGCTGGAG
AACAGCGGCGGCGGGGGTGTACCGGCGGCGGTATCGTCGTCATCGGCTGCGGTTGGTGGC
GGCGTCAATGCGGGGGGTGGTGGCAGGCAGGAGTGCTCGGTCGACCTCAAGCTCGGCGGG
TTGGGGGAGTTCGGCGGCGGCGGCGCGCAGCCGCGGGTCGCCGTGGCGGGCGAGCCGGCC
AAGGGGAAGGGGCCAGCGGCCGCCGCCACGGGAGCAGCAGCAGCAGCGTCGTCGGCGCCG
GCGAAGCGGCCGCGCGGTGCGGCGGCGGCGGGGCAGCAGCAGTGCCCGTCGTGCGCGGTG
GACGGGTGCAAGGAGGACCTGAGCAAGTGCCGCGACTACCATCGCCGGCACAAGGTGTGC
GAGGCCCACTCCAAGACCCCCCTCGTCGTCGTCTCCGGCCGCGAGATGCGCTTCTGCCAG
CAGTGCAGCAGGTTTCACTTGCTTCAGGAGTTTGATGAGGCCAAGCGCAGCTGTAGAAAG
CGACTAGATGGGCACAACCGTCGCCGCAGGAAGCCACAGCCAGATCCCATGAACTCTGCA
AGTTATCTTGCAAGCCAACAAGGGGCAAGATTCTCACCGTTCGCGACGCCGAGACCGGAG
GCAAGCTGGACAGGGATGATCAAAACCGAGGAGAGCCCATACTACACGCACCACCAAATC
CCTCTTGGCATCAGCAGCAGGCAGCAGCATTTCGTTGGCTCCACCTCTGACGGCGGCCGC
CGCTTCCCTTTCCTCCAGGAAGGCGAGATCAGCTTCGGCACCGGCGCCGGCGCCGGCGGC
GTGCCAATGGATCAGGCAGCAGCTGCTGCTGCTGCTTCAGTGTGCCAGCCACTTCTGAAG
ACGGTAGCTCCTCCTCCTCCTCCTCATGGCGGCGGCGGCAGCGGCGGCGGCAAGATGTTC
TCCGATGGTGGGTTGACACAAGTGCTCGACTCCGATTGTGCTCTCTCTCTTCTGTCAGCT
CCGGCGAACTCCACGGCCATCGACGTCGGCGGTGGCCGGGTGGTCGTCCAGCCGACCGAG
CACATCCCCATGGCGCAGCCTCTCATCTCTGGCCTTCAGTTCGGCGGCGGCGGCGGCAGC
TCAGCCTGGTTCGCGGCGCGGCCGCATCATCAGGCGGCCACCGGCGCCGCCGCCACCGCC
GTCGTCGTCTCGACGGCCGGTTTCTCCTGCCCGGTGGTGGAGAGCGAGCAGCTGAACACA
GTCCTGAGCTCCAATGACAATGAGATGAACTACAATGGGATGTTTCACGTCGGCGGCGAA
GGCTCATCGGATGGCACGTCGTCGTCTCTGCCGTTCTCATGGCAGTAG

Protein

456 aa

>Os08t0531600-01 Transcription factor, Positive regulator of cell proliferation, Control of grain size, shape and quality
MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNAGGGGRQECSVDLKLGG
LGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAKRPRGAAAAGQQQCPSCAV
DGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQQCSRFHLLQEFDEAKRSCRK
RLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPRPEASWTGMIKTEESPYYTHHQI
PLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGAGAGGVPMDQAAAAAAASVCQPLLK
TVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCALSLLSAPANSTAIDVGGGRVVVQPTE
HIPMAQPLISGLQFGGGGGSSAWFAARPHHQAATGAAATAVVVSTAGFSCPVVESEQLNT
VLSSNDNEMNYNGMFHVGGEGSSDGTSSSLPFSWQ*

5'UTR

chr08:26501167..26501222 (+ strand) : 56 bp

CDS

chr08:26501223..26501713 (+ strand) : 491 bp

chr08:26504616..26504746 (+ strand) : 131 bp

chr08:26505189..26505934 (+ strand) : 746 bp

3'UTR

chr08:26505935..26506198 (+ strand) : 264 bp

FASTA

>Os08t0531600-01 class=Sequence position=chr08:26501167..26506198 (+ strand)
ACAGCTCAAG CTTACGCGGG AGCTAAGCTG AGCTACAGCG AGCGGCGGCG GCGGCCATGG AGTGGGATCT CAAGATGCCG
CCGGCGGCGA GCTGGGAGCT AGCCGACGAG CTGGAGAACA GCGGCGGCGG GGGTGTACCG GCGGCGGTAT CGTCGTCATC
GGCTGCGGTT GGTGGCGGCG TCAATGCGGG GGGTGGTGGC AGGCAGGAGT GCTCGGTCGA CCTCAAGCTC GGCGGGTTGG
GGGAGTTCGG CGGCGGCGGC GCGCAGCCGC GGGTCGCCGT GGCGGGCGAG CCGGCCAAGG GGAAGGGGCC AGCGGCCGCC
GCCACGGGAG CAGCAGCAGC AGCGTCGTCG GCGCCGGCGA AGCGGCCGCG CGGTGCGGCG GCGGCGGGGC AGCAGCAGTG
CCCGTCGTGC GCGGTGGACG GGTGCAAGGA GGACCTGAGC AAGTGCCGCG ACTACCATCG CCGGCACAAG GTGTGCGAGG
CCCACTCCAA GACCCCCCTC GTCGTCGTCT CCGGCCGCGA GATGCGCTTC TGCCAGCAGT GCAGCAGGTA ACCCCCCCCC
CCCCCCCCCA ACCATTGTCT CCTTCCTTCC CGCCAAATTC ACTGCAAAAC AAAAAAAAAA TCGTAGCCCA AAACACCCCA
AGACGTCATG GCAATTCGCA TCAAGAACTG CATATATCAA TTTCTCCACT TCTTTTCAGC GTCACTGTCT CTGATCATTC
TCTTTGCTGA ACAAAAGAAA AAGAAGATAA GCAAGAGTTT TTCTCTTTTT TTTGCTCCTT TTTTTTTTGG CTTTGCACAA
TCTCTTCTTG CTTCCAGTTG CAACTGACCA TTGTGCAGTA CATGCATCTG CATCTACTGA TTCTAATTTC TACGCTACTT
CGGATCAAAA TTAATTCAGT ACTGCAAAGC ACAATTTCAT TGATCCATTT CATCCAGCCT CGGACTTTGT TCATCATCAT
CTATCTGTCT CTTACTTCCT TTCCATTGGG AGCATACTAT CCGGCTGTCT CGTTTCAGGG ACGCACAGCT TTGCCTTTAA
TGGCATGCCT TTTCAGCCTT CCCTCATGCT ATCCTTTAGC TCGGCAACTC GTATTACCCC AAATTATTAC CTCTTTGCTC
GCCTTTAGAT TTATTACTAT CATCTTTTCT TTTCTTTTTT ATATCTCTTC TTCACCAGTA GCTGCACTGT TTTTGCACTG
CTCAAGAGCA AAGCAGCTGC TGTAGTTGTT CAGTGTTTGT TGCTTACTGA GAAAAAAAAG TGATAGAGAC AGAAAAAAAA
GTGAGGGAGA GAAAAAAAAA AAAACAGAAC TGACGCCTGA ATCTCATCAG CCAGAGATCA CATTAGGCAA TTTACCACCA
GACTGTTATG ATATTATTTT CAGTGTCCTC CTGTCTGAAT ATGACCGTCT GCTTCCTCTA ACAAGAACAA TAAATCAGCA
CCTAGTTCAG TACTAACTAA TTTTCTCATG AATAAATAAA TAAATATAGT CACTGTAATT AGTGACACTA CTAGCACGGT
AGCACCTGGT TTAGTGGTTA ACAATACTTG GTTCTTGCAC TTCTCCCTGT CGATGTTTTT TCGCGTGGGG GCTAGCTATC
GATTGATTGA TTCCTCAACT ATGGCATCGA AACTGGAAGA ACATATGCAT ACTGGGACAC ACACCCTGCT TGCTTTCTGA
ATTTCTGATT TCTCCTCAAG GCAGCTGGCC TACCACATAT ATCTGACTGA GCTGTGCTGC TTCTTGCCAT GAGAGCTAAG
CTACCTTAGC TTAGCTACTA CTACCACTTA CTACGCCGTC TGTTTTGGAA GGGAAAGGCA GATGTGGATG CCCAAACCTA
GAAAGATGGT TGTACCACTG AAAGAGAGAG TTTGTGGATG TGATCTGCAC TAAAGCACCC CTGTACAGGG AAAGGACCAT
GTAGCCCTAC TACAAGTTCA CCATTTACAC CTCTGTTCCT AAGGTTGGGC CACACATATA TGAAGCTTTT AATGTCTCGG
TTTGTTGGAA AGGGTTTTGC ATTGCCATTA CAAGCCAGCA CAGTGGATAC AGATAGCCAG GGTGCTCTCT ATTGGAGAAG
AAAAAAAATG GAGCCCTGAA CACCCTGATT GGATCTCACT ATTGCATGAA AGAATGATGA GATTTCTTGT CTTATAATTT
TTAAAGATTT TTTTTCTAAA GTCAGTCTTA GTTACATTCA TTTGTTATAT TCCAGTTTCA GACTTATTGG TACTAGGTTC
TGTGAGATCT TTTTTTTTTT TTACATCGTT TGAGTATCAT AGGGTGATTC AGTACCACCT TGACCCCTGT TTTTATCAGA
GCTCTAAACT TCTAACACCA CTTCTAACTT TTGAGCTAGT CTTCTAACCT TGCTGTTTTC TGAACAAAGA TGTATACTCA
AGATTGGTCA TAGATGGAGA TATTCTGTGA ACAGAACTAA CATAATAGCA CCAAATTAGT CAGACATACT CTTTACAAAA
TTACTTTGGA GTTTGTTGTC CACTCCTTGA ACTAGTACAA TATTGTCCTA CTGAATGCCT TCCTGCCTTT CAACTTGAAA
GTTCCCTATT TTATCTGTTA GTTCTTTTAT AAAATGTAAC TGCACATTGT CAGAAGGATT TGCATCTTAT TTCACTTTGC
GCCAGTTTTA AGTAATACAT GGTATATTGG CATAAGACCA GACTCTACCA TTTTTTATCT TGCAGAGACA TAGCAAACAA
CTAAGTACTT TTTATTGTGG TGTGCTCCTT TACACAGTAG CACAACTTGT AGGATGCTTA TGTGATTGTC TCATCAATTA
TTCTCTTTAT CTTTAAAAAG AGAATGATAC AAAAAATCTC TTTATCTGAG AATACACATT ACCCAGTGGG GACAGTCTTT
CAATGATTTG ATTACTTCGT CAGTGTTTGC AAACTGGGAA GATCATTATG CTGCTGCATG CAGACTTTAT AAATTAAGTG
ATCTTCAGAG TCAGAACAAG ATGTTAGCTT TCTATACCTA TGGATCCACA TCCACTGTAT TGTGGTCCAT GTACAAGTGG
GGTTAAAATA TTTTTCTGCC GTTGACAGAA CTTCAGTTCA ATAAATTTAT CTAAGATGAA GTATCCAAGC ACGGAAAGAG
CTAATTAACT GATGAAATTC CTGTGGTCCC TTGTGTTGGT ATATGAGTAT TCTAAGAGAG AATATGGAGA CAGTATATTA
AATTATTCTG AGAATACTTA TCCTGACGTT TCTTTAGTGA GAACTGTGGT GCATCGTTAC AAAACTTCAG ATCATGTTTC
AGGAGTATTT TATCATGTAA GAATTTTAAA AAGACGTACA TCCTAGGTAC AGTCATTTCT TAAGGTTTCA TGGTACTGAA
TGATTAAATT ACTTCTTCTG GATTGGGTTT CAAGCATCAT TTGGCTAATT TCAATGCAGT TAAATGATCA TAAGCTTTTC
TTTCTTCAGG TTTCACTTGC TTCAGGAGTT TGATGAGGCC AAGCGCAGCT GTAGAAAGCG ACTAGATGGG CACAACCGTC
GCCGCAGGAA GCCACAGCCA GATCCCATGA ACTCTGCAAG TTATCTTGCA AGCCAACAAG GTATTTTCTT GTTTATTATT
ACCACTCTAT GATATCGCAG TTCATATAAG ATTAACTGGG ATATAGTCAT TCAGACTTCC TAACTATTGT TAGACTAGGA
AAAAAACTAT GAAACATGCT AATAGCATAG ATAAGTCATG GTAAAAAAAA AGTAAAAGAA AATGAAACTG TGGTTaaaaa
aaaacgcaaa tattagggaa tgacctaata tcaaataatt agaaggagtg aggcttcgaa cccaggtcgt ctagcccatc
accttttgaa gctagccaga aaacccctgg gcgtttctcA GAACTGTGGT TCAGCTATGA CTCTGTTCTT TCAATCCTGA
CATCTTGTAA CATGTAATGC ATTCTAGTAT ACATCTAATG CATTGAACCA TATCTTATGT ACTAATTTGT GCTGATATAT
CAAACATCGC ATCAAAATTC AGGGGCAAGA TTCTCACCGT TCGCGACGCC GAGACCGGAG GCAAGCTGGA CAGGGATGAT
CAAAACCGAG GAGAGCCCAT ACTACACGCA CCACCAAATC CCTCTTGGCA TCAGCAGCAG GCAGCAGCAT TTCGTTGGCT
CCACCTCTGA CGGCGGCCGC CGCTTCCCTT TCCTCCAGGA AGGCGAGATC AGCTTCGGCA CCGGCGCCGG CGCCGGCGGC
GTGCCAATGG ATCAGGCAGC AGCTGCTGCT GCTGCTTCAG TGTGCCAGCC ACTTCTGAAG ACGGTAGCTC CTCCTCCTCC
TCCTCATGGC GGCGGCGGCA GCGGCGGCGG CAAGATGTTC TCCGATGGTG GGTTGACACA AGTGCTCGAC TCCGATTGTG
CTCTCTCTCT TCTGTCAGCT CCGGCGAACT CCACGGCCAT CGACGTCGGC GGTGGCCGGG TGGTCGTCCA GCCGACCGAG
CACATCCCCA TGGCGCAGCC TCTCATCTCT GGCCTTCAGT TCGGCGGCGG CGGCGGCAGC TCAGCCTGGT TCGCGGCGCG
GCCGCATCAT CAGGCGGCCA CCGGCGCCGC CGCCACCGCC GTCGTCGTCT CGACGGCCGG TTTCTCCTGC CCGGTGGTGG
AGAGCGAGCA GCTGAACACA GTCCTGAGCT CCAATGACAA TGAGATGAAC TACAATGGGA TGTTTCACGT CGGCGGCGAA
GGCTCATCGG ATGGCACGTC GTCGTCTCTG CCGTTCTCAT GGCAGTAGTT TTTTCAGTAA CTGTATGTTG CTGCCTTAGT
TTCAGTAGAG TTGGTTCTTC ATTTCTTTTC AGTGATCAAA TTATTGTTTC TGTTCTTTTC TGCCATGGTA AGTTCCTTTT
TTTTTTCTTC TTCTTGCCTT CATTTGAGTT AATTACAGCA TTGATTTGTG TGAACAAAAT TCATCATAAA TCAGTTCCTC
GCGAGATCAT TGGTCTCAAC ATGATGGTGC CAAGTGAGAA CTGCAGTATT GTGCAGTTTT CAGTTTTGAG TC