Os08t0531700-01

Locus

Os08g0531700

Description

MADS-box transcription factor, Regulation of floral identity, Regulation of amylose content at high temperature

RAP-DB Gene Symbol Synonym(s)

OsMADS7

RAP-DB Gene Name Synonym(s)

MADS-box transcription factor 7

CGSNL Gene Symbol

MADS7

CGSNL Gene Name

MADS BOX GENE 7

Oryzabase Gene Symbol Synonym(s)

OsMADS7, OsMADS45, FDRMADS1, RMADS216, AGL6, M79, MADS45, Os MADS7, Os MADS45, OsMADS7/45

Oryzabase Gene Name Synonym(s)

MADS box gene7, Protein AGAMOUS-like 6, MADS-box protein 45, MADS box gene45, MADS-box transcription factor 7, Protein AGAMOUS-like 6

Transcript Evidence

AK100263

Protein Evidence

Q0J466

Literature

PMID: 28429576

PMID: 20003164

Note

Manual Curation

May 15, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: positive regulation of transcription by RNA polymerase II (GO:0045944)

Molecular Function: RNA polymerase II regulatory region sequence-specific DNA binding (GO:0000977)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box superfamily (IPR036879)

Transcription factor, MADS-box (IPR002100)

MADS MEF2-like (IPR033896)

Transcription factor, K-box (IPR002487)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023063L04 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0531700-01)

RiceXPro (AK100263)

Others

Oryzabase (3079)

KEGG (Os08t0531700-01)

Transcript

1054 bp

>Os08t0531700-01 MADS-box transcription factor, Regulation of floral identity, Regulation of amylose content at high temperature
AGTGGTGGTGGTGGTGGTGGTGAGATCTAGCTTGGTTGGTTGGTTGCAGCTGGAGATCGA
TCGGGATGGGGAGGGGTCGGGTGGAGCTGAAGAGGATCGAGAACAAGATCAACCGGCAGG
TGACGTTCGCCAAGCGCAGGAATGGCCTGCTCAAGAAGGCGTACGAGCTCTCCGTCCTCT
GCGACGCCGAGGTCGCCCTCATCATCTTCTCCAACCGCGGCAAGCTCTACGAGTTCTGCA
GCACCCAGAGCATGACTAAAACGCTTGAGAAGTATCAGAAATGCAGTTACGCAGGACCCG
AAACAGCTGTCCAAAATAGAGAAAGTGAGCAATTGAAAGCTAGCCGCAATGAATACCTCA
AACTGAAGGCAAGGGTTGAAAATTTACAACGGACTCAAAGAAATTTGCTGGGTGAAGATC
TTGATTCATTAGGCATAAAAGAGCTCGAGAGCCTAGAGAAGCAGCTTGATTCATCCCTGA
AGCACGTCAGAACTACAAGGACAAAACATCTGGTTGACCAACTGACGGAGCTTCAGAGAA
AGGAACAAATGGTTTCTGAAGCAAATAGATGCCTTAGGAGAAAACTGGAGGAAAGCAACC
ATGTTCGCGGGCAGCAAGTGTGGGAGCAGGGCTGCAACTTAATTGGCTATGAACGTCAGC
CTGAAGTGCAGCAGCCTCTTCACGGCGGCAATGGGTTCTTCCATCCACTTGATGCTGCTG
GTGAACCCACCCTTCAGATTGGGTACCCTGCAGAGCATCATGAGGCGATGAACAGTGCGT
GCATGAACACCTACATGCCCCCATGGCTACCATGATGATGACGGGGACAATGAATTACGA
AATAACAAGGATATGTGGCATATATGTGGTGCCGCATACATGCATGTATCATGGCTAGCT
ACTTAATTGGAGTGATGGATTTGAACTAGTTTCGTATGTAGCCTGTTTGTGTGTAACTTG
TGTGAGATACTACCTTAAAAACTATCGGTGTCTGTTGAACATATTCTGCGATCAACTTTA
AGCGTATTATTATCATTTTCATTCCATTCTGTTT

CDS

750 bp

>Os08t0531700-01 MADS-box transcription factor, Regulation of floral identity, Regulation of amylose content at high temperature
ATGGGGAGGGGTCGGGTGGAGCTGAAGAGGATCGAGAACAAGATCAACCGGCAGGTGACG
TTCGCCAAGCGCAGGAATGGCCTGCTCAAGAAGGCGTACGAGCTCTCCGTCCTCTGCGAC
GCCGAGGTCGCCCTCATCATCTTCTCCAACCGCGGCAAGCTCTACGAGTTCTGCAGCACC
CAGAGCATGACTAAAACGCTTGAGAAGTATCAGAAATGCAGTTACGCAGGACCCGAAACA
GCTGTCCAAAATAGAGAAAGTGAGCAATTGAAAGCTAGCCGCAATGAATACCTCAAACTG
AAGGCAAGGGTTGAAAATTTACAACGGACTCAAAGAAATTTGCTGGGTGAAGATCTTGAT
TCATTAGGCATAAAAGAGCTCGAGAGCCTAGAGAAGCAGCTTGATTCATCCCTGAAGCAC
GTCAGAACTACAAGGACAAAACATCTGGTTGACCAACTGACGGAGCTTCAGAGAAAGGAA
CAAATGGTTTCTGAAGCAAATAGATGCCTTAGGAGAAAACTGGAGGAAAGCAACCATGTT
CGCGGGCAGCAAGTGTGGGAGCAGGGCTGCAACTTAATTGGCTATGAACGTCAGCCTGAA
GTGCAGCAGCCTCTTCACGGCGGCAATGGGTTCTTCCATCCACTTGATGCTGCTGGTGAA
CCCACCCTTCAGATTGGGTACCCTGCAGAGCATCATGAGGCGATGAACAGTGCGTGCATG
AACACCTACATGCCCCCATGGCTACCATGA

Protein

250 aa

>Os08t0531700-01 MADS-box transcription factor, Regulation of floral identity, Regulation of amylose content at high temperature
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCST
QSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLD
SLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHV
RGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGYPAEHHEAMNSACM
NTYMPPWLP*

5'UTR

chr08:26507926..26507990 (+ strand) : 65 bp

CDS

chr08:26507991..26508175 (+ strand) : 185 bp

chr08:26509100..26509178 (+ strand) : 79 bp

chr08:26509403..26509471 (+ strand) : 69 bp

chr08:26510657..26510758 (+ strand) : 102 bp

chr08:26511135..26511176 (+ strand) : 42 bp

chr08:26511268..26511309 (+ strand) : 42 bp

chr08:26511594..26511751 (+ strand) : 158 bp

chr08:26511950..26512022 (+ strand) : 73 bp

3'UTR

chr08:26512023..26512261 (+ strand) : 239 bp

FASTA

>Os08t0531700-01 class=Sequence position=chr08:26507926..26512261 (+ strand)
AGTGGTGGTG GTGGTGGTGG TGAGATCTAG CTTGGTTGGT TGGTTGCAGC TGGAGATCGA TCGGGATGGG GAGGGGTCGG
GTGGAGCTGA AGAGGATCGA GAACAAGATC AACCGGCAGG TGACGTTCGC CAAGCGCAGG AATGGCCTGC TCAAGAAGGC
GTACGAGCTC TCCGTCCTCT GCGACGCCGA GGTCGCCCTC ATCATCTTCT CCAACCGCGG CAAGCTCTAC GAGTTCTGCA
GCACCCAGAG GTTCATTTCA TTTCCTAGCT ACTCTAATCC ATCCATCAAA CCCACATCAC ATCACACTTC AATTTCGCAA
GCTTAATTAG CCACCCTTTC GATTGGATCT GTCCTGTCCA GATCTGTTCA TGCATCATCA AAAGCTAGCT GCATCTGCCT
TTTGCCCGGA ATTCCAGCTG CATGCTATGC CGGCTTGATT TCTGCATACG ATCTTTTGAC AAGAAACGAG CTGTGGCGTG
TTCAACCGCA CGCTACCTAG CTAGCTAGAT TGCTCTTGCT TCCGTGGGTT TTCACGCCGG GATAGATCTG GGCAATATCC
TGGGTTTAGG GTTTTGCTTC CTGGTCCGTG TGGTAGATCG GTGCACATCT TTAGTTTGCC AGTTGGTTTC CTTCTCCGAT
CTGTCCGTCT TACGTGCGAT TTCTTCATGT GTGGTCTCGG AACTCGCAAA GGAACTGAAA AGTTTGCTTA TTTACGACCT
TTTCTTCTGG ATCTGCAAGG TTCTTTGTTT CCCTTAGCTA AATCCTTAAA AGAAGTAGTC CAATATATAC TTCCATGCAT
AATATTGCAA AATAAATGAT GGTTTGTTGA TAACCAAAGT AAAGAGACAT AAAAACTAAC TAGAGACTTT TTTTTTCAAA
AAAAAAAAAG AAGAATCTTG TCTACTGTGT TATATATCAG TAGTATATAT ACAGAGATCA ACGGCTTCAG TCTACTAATC
AAACAATATA ATCTCATAGG GGGACTTGCA AGAACCATAT GTTCCATTTC TGAATGTATT TTAAGCTAGA ATGCATGACA
ACGAAAAAAG GGCATTGTGG TAGTAAATGT GCCATGCCCC TATTGTAGAT CTTAATCATC GTTAATCTCT CCTTCTTGTG
ATCCCATGCA TGCACTAATT TTAATTAATT CCTCATGTCT TTTGAACTTT GTAGCATGAC TAAAACGCTT GAGAAGTATC
AGAAATGCAG TTACGCAGGA CCCGAAACAG CTGTCCAAAA TAGAGAAAGT GAGGTAATTA TTAATTGTGT TCATTAATTA
CACCCATTAT TATGCAGCAA ACTAATTTTG GTTTGACCAC ATAAGTGTTT TCTCACATGT AACATTACTT TTCTACTACC
ATAATAGCAT GTGCATATGA AGGAGATGGT TTGCAATTGC AATATGTTAT ATACATATGT CCTACACATG CATTTTCAAA
ACATCGAATT AATGGTCAAC TATTTTGTTT CTTTCAGCAA TTGAAAGCTA GCCGCAATGA ATACCTCAAA CTGAAGGCAA
GGGTTGAAAA TTTACAACGG ACTCAAAGGC AAGTTATGAT GCATTTTCAC TGATAAGCTT CTCTCTTGAT GATGCTTTTA
GGTTTGCATT TAGACGATTT TATGCAAGAG CGGTTTTGTA CCACAAAAAT ATGATTTTCG ATGTCATAGC GCTGCAAGAA
TGATGTGAAT AAACTCATAG TATTTCTTTT TATAGTGCTG TCGTTATAAA CAAAAAAAAT ATCATGTTAA CAGTAATTAA
ATGTTGATTC CAGCTAATTG CTTGGATGTT ATCAGCCTAG AGAACCTTAG GTGGGCATCC TAATTTTAAG GTATAGTAGC
ACAACTACTA GCTATTATAG GCGGGCTATC AATAGGTAGA ATAATAAAAA CAAAGCACAA ACAGTGTACC ATAtactccc
tccgtctcat aaaaaaacca acctagtact ggatgtgaca tatcttagta ctacaaatct aaacataggc tgtgtttagt
tcggtccaaa gtttggaatt tggttaaaat tagagacgat gtgactgaaa agttgtgtat gtatgaaagg tttgatgtga
tggaaagttg gaagtttgga aaaaaaaact ttggaactaa acaCATCAAT ACCTTTGTTC AGattcatta tactagaatg
tgtcacatct gatcctagat tcgttttttt gggacagagg gagAAAGTCA CAAGCTCATA GAATAAATCA ATCATACAAC
TAGTATAAAG CATCTCAAAT CTATTTTGTT TTATCAAAAT CTAGTTGAGG ACACACATAT ATACAATCCA GGTTCTTATA
GCATTCTCAC CATTAATTAA TTAACCAATA GATCAAGAAA TCAACTGTAC TACTCAAAAT TAGACAGGCA GCTGTCGACC
AGCTGATAAG ATCTATATAT AACATGATGT ATATACATGT CATTGGTAAA AAAAAATCAC ATACATGCAT GTCATAGTAG
TACTACTCGC AGGTCGTAGT TCCAACATGC AACTGCATAA TGAAGAAGTA CATAGTATTG AGTATTAGCT TAGCTGTTAC
ACATGTAATA ATACATCATT TTGAAACACA CGCTGTAAGT TAAATTTTAT TTGGAAACAT TAGTAGTTAA TTAACTTCAT
TTTTGTACTT CAATATAGTA ATTGAAAGTG GAAGTCTAAT TTTCATATGT ACATAACTAA TACTCTTCTA CCCCTATGTG
TGGACTATGA CAGAAATTTG CTGGGTGAAG ATCTTGATTC ATTAGGCATA AAAGAGCTCG AGAGCCTAGA GAAGCAGCTT
GATTCATCCC TGAAGCACGT CAGAACTACA AGGGTAATGA TTGTTTTTGG GTGCTAGATC ACAAACAAGT ACCATGCATG
CATGcatgta ctccctctgt gaaaaaaaaa attccaatcc tagttatgac agtgtgtaca cgtgtatcta agtttctagt
tagaattgtg ttttgtattg gacgaagggt gtaggtGTGT AGCACTAGTT TTTGAAGTAA CACAAAGGAG TACATACACA
CCATATATGT TGCATGCAGA TGCAATTGAC TTAAATGCAG CCCTATTGTT GATCGTGTGG ATAGCTACCT CACGCAATTA
TTAATTTCCT GCGTAAAATT TATAGGAACC CATGCATGAA AGATCTGAAT TGTAAATCTT ACTTGTCAAT GCTTTTAATC
CTCTTGTAGA CAAAACATCT GGTTGACCAA CTGACGGAGC TTCAGAGAAA GGTATATTTT TAAGAATTAT CAATAAAAAG
TGTTGATCAC ATTTTTCTTC CTTAGCAGTA GTAGATATTG ACCCTGTTTA CTTAATTTAC AGGAACAAAT GGTTTCTGAA
GCAAATAGAT GCCTTAGGAG AAAAGTAAGT TATACAACTC TTCCATCTTT CTCCTTAGGA GAAAAGCAAG TTATACAACT
CTTCCATCTA AAGAAAGGTT TATTCAACTA ATCATTCATG ACCAAGAATC TTAAGATAAA CCTCAACTGA ACTATGGTGT
GTTTCCTATA TATATGAATT ATGGAGTATA TAGTCCATGA TCAATATAAT GCAGATATCA TGGAATGGAA GCCCTGATTA
ATGTAGTGAA AGGGATATTG AAAATAACTG CAATGTGATA TCATTTAAAT TGTTTTGAAA AACTGTAGCT GGAGGAAAGC
AACCATGTTC GCGGGCAGCA AGTGTGGGAG CAGGGCTGCA ACTTAATTGG CTATGAACGT CAGCCTGAAG TGCAGCAGCC
TCTTCACGGC GGCAATGGGT TCTTCCATCC ACTTGATGCT GCTGGTGAAC CCACCCTTCA GATTGGGTAT GCTCATATGA
TCTCTTCCTA TATATACTTG GAACCAATTG CCGGTCTATA TATATAATCT GATCCAGGAC AATATAGCTA GCTAGGCTAG
TTTTTGTATA TGCACACTTA ATATTGTATA GATCTTTAAA TAATGGCTAT ATTTTTTTGC TTATATATGC CTCTGAAAGT
CTGAATGTGA TACCTGTTTT GCAGGTACCC TGCAGAGCAT CATGAGGCGA TGAACAGTGC GTGCATGAAC ACCTACATGC
CCCCATGGCT ACCATGATGA TGACGGGGAC AATGAATTAC GAAATAACAA GGATATGTGG CATATATGTG GTGCCGCATA
CATGCATGTA TCATGGCTAG CTACTTAATT GGAGTGATGG ATTTGAACTA GTTTCGTATG TAGCCTGTTT GTGTGTAACT
TGTGTGAGAT ACTACCTTAA AAACTATCGG TGTCTGTTGA ACATATTCTG CGATCAACTT TAAGCGTATT ATTATCATTT
TCATTCCATT CTGTTT

Locus: Os08g0531700

Loading...

Locus: Os08g0531700

Loading...