Os08t0534950-00

Locus

Os08g0534950

Description

Similar to calmodulin binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAUR34

CGSNL Gene Name

SMALL AUXIN-UP RNA 34

Oryzabase Gene Symbol Synonym(s)

OsSAUR34

Oryzabase Gene Name Synonym(s)

Small auxin-up RNA 34

Transcript Evidence

tplb0019a16 (Wheat FLcDNA)

Protein Evidence

NP_001149909.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Auxin responsive SAUR protein (IPR003676)

Expression Databases

TENOR (Os08t0534950-00)

Others

Oryzabase (9159)

Transcript

499 bp

>Os08t0534950-00 Similar to calmodulin binding protein.
ATGAAGGAGAGAGGTGTGAGGAACAAGCAGGGAGTGATCATGAAGGCCCTGCTGGACAGG
TGTTTGTCCAAGCACAGGAATGGTGGCTGGCCGGAGCCGCCGGAGGGGAGCTTCGCGGTG
TACGTCGGCGGCGGCGGCGGCGGCGGAGGGGCGGCGAGGGAGAGGTTCGTGGTGAGGACG
GAGTGCGTGAACCACCCGCTGTTCAGGGCGCTGCTGGAGGAGGCCGAGGAGGAGTACGGG
TACGTGGCGGACGGCCCGCTCGAGCTCCCCTGCGACGCCGGCGAGTTCGTCGCCGTCCTG
GCGAGGATCGAGCGTGAGATGGCCGAGGAGAGGACGGTCGGGTGCGCCGGCGGCCTGGTG
TTCAGGCTGCACCCGGCGGCGCACCTCATGCTGGTTGCTCCGGCGACGCCGCCGCCGATG
ATCGTTGGCTGAGCGTCCGGTGCGGCAAGGCCGGTCGCCGGCGGTGATCGCCGGCTGATG
GGCTAGCTGTTGGCATGTT

CDS

432 bp

>Os08t0534950-00 Similar to calmodulin binding protein.
ATGAAGGAGAGAGGTGTGAGGAACAAGCAGGGAGTGATCATGAAGGCCCTGCTGGACAGG
TGTTTGTCCAAGCACAGGAATGGTGGCTGGCCGGAGCCGCCGGAGGGGAGCTTCGCGGTG
TACGTCGGCGGCGGCGGCGGCGGCGGAGGGGCGGCGAGGGAGAGGTTCGTGGTGAGGACG
GAGTGCGTGAACCACCCGCTGTTCAGGGCGCTGCTGGAGGAGGCCGAGGAGGAGTACGGG
TACGTGGCGGACGGCCCGCTCGAGCTCCCCTGCGACGCCGGCGAGTTCGTCGCCGTCCTG
GCGAGGATCGAGCGTGAGATGGCCGAGGAGAGGACGGTCGGGTGCGCCGGCGGCCTGGTG
TTCAGGCTGCACCCGGCGGCGCACCTCATGCTGGTTGCTCCGGCGACGCCGCCGCCGATG
ATCGTTGGCTGA

Protein

143 aa

>Os08t0534950-00 Similar to calmodulin binding protein.
MKERGVRNKQGVIMKALLDRCLSKHRNGGWPEPPEGSFAVYVGGGGGGGGAARERFVVRT
ECVNHPLFRALLEEAEEEYGYVADGPLELPCDAGEFVAVLARIEREMAEERTVGCAGGLV
FRLHPAAHLMLVAPATPPPMIVG*

CDS

chr08:26694538..26694969 (- strand) : 432 bp

3'UTR

chr08:26694471..26694537 (- strand) : 67 bp

FASTA

>Os08t0534950-00 class=Sequence position=chr08:26694471..26694969 (- strand)
ATGAAGGAGA GAGGTGTGAG GAACAAGCAG GGAGTGATCA TGAAGGCCCT GCTGGACAGG TGTTTGTCCA AGCACAGGAA
TGGTGGCTGG CCGGAGCCGC CGGAGGGGAG CTTCGCGGTG TACGTCGGCG GCGGCGGCGG CGGCGGAGGG GCGGCGAGGG
AGAGGTTCGT GGTGAGGACG GAGTGCGTGA ACCACCCGCT GTTCAGGGCG CTGCTGGAGG AGGCCGAGGA GGAGTACGGG
TACGTGGCGG ACGGCCCGCT CGAGCTCCCC TGCGACGCCG GCGAGTTCGT CGCCGTCCTG GCGAGGATCG AGCGTGAGAT
GGCCGAGGAG AGGACGGTCG GGTGCGCCGG CGGCCTGGTG TTCAGGCTGC ACCCGGCGGC GCACCTCATG CTGGTTGCTC
CGGCGACGCC GCCGCCGATG ATCGTTGGCT GAGCGTCCGG TGCGGCAAGG CCGGTCGCCG GCGGTGATCG CCGGCTGATG
GGCTAGCTGT TGGCATGTT

Locus: Os08g0534950

Loading...

Locus: Os08g0534950

Loading...