Os08t0535700-00

Locus

Os08g0535700

Description

Similar to glycerophosphodiester phosphodiesterase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSTA217

Oryzabase Gene Name Synonym(s)

Transcript Evidence

BT037277 (DDBJ)

Protein Evidence

NP_001150964.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: glycerol metabolic process (GO:0006071)

Biological Process: lipid metabolic process (GO:0006629)

Molecular Function: phosphoric diester hydrolase activity (GO:0008081)

Molecular Function: glycerophosphodiester phosphodiesterase activity (GO:0008889)

Functional domain (InterPro)

Glycerophosphoryl diester phosphodiesterase (IPR004129)

PLC-like phosphodiesterase, TIM beta/alpha-barrel domain (IPR017946)

Expression Databases

TENOR (Os08t0535700-00)

Others

Oryzabase (19489)

Transcript

1270 bp

>Os08t0535700-00 Similar to glycerophosphodiester phosphodiesterase.
AATGGCGCTCCCGGCGGCGACGGCCCGCGCGGCGGCGCTGTGCCGGATCGCGGCGTGCGC
GTCGGCATCGTCGGCGGCGGCGGCGGCGACCGGGGGGAGGCGCGGGGCGGAGAAGCTGCC
GTTCTCGCTGGCGGAGCGGGGGATGGTGGTGGGGGGGCACCGCGGGATGGGGATGAACGC
GGTGGGGGCGCCGCCGGGGGCGCGGATCGAGGCGGTGAGGGAGCGGGAGAACACGCTGCT
CTCGTTCGGCCGTGCCGCCGCGCACGCCGCCGTCGCCTTCGTCGAGTTCGACGTCCAGGT
TACAAAAGATGGCTGCCCAATAATCTTCCATGATGACTTCATCCTAACACAAGAAACTGA
TGCAGTCTATGCAAAGCGTGTTACTGATCTTCTCTTGGAAGAATTTCTTTCATATGGGCC
GCAAAAGAATTCCCATGAGGTGATTTACTCCTTTTTTTGTTGGCTTCTGCTGTGCCAAGT
TCATGGTTATGAATGCATTTTTGAGATGCCATTTTGTAAACTTGCCCTTATGTTGATTGT
TCAGATCTCCAAGCCATTGCTTAGACGGACCAGCGATGGTAGAGTTGTTAACTGGAGCGC
AAAAGATGATGATTCCCTATGCACATTGCAAGAAGTCTTTGAACGTGTCAGTCCTCGTCT
AGGATTTAACATTGAGCTAAAGTTTGATGATGACATCTTCTATGAAAGGAGTCAACTTGA
CCGTGCGCTTCAAGCTGTATTGCAAGTTGTTTCTCAGTATGCAAGCAATAGGCCTGTATT
TTTCTCAACCTTCCATCCTGATGCGGCAAGGATTATGAGGGAACTTCAGAGCTTATATCC
TGTACTCTTCTTAACAGAAGGAGGAACAGCTCAACACAAAGATTCAAGAAGGAACTCACT
TGATGAAGCTATCCGGGTCTGCCTAGAGTACGAGTTGCATGGACTTGTATCAGAGGTAAG
AGGGGTTTTAAAGAATCCCTCTGCAGTCCTTAGAGCAAAAGAGTCCAACCTTGCACTTCT
GACCTATGGGCAGCTCAATAATGTGTGGGAGGCTGTGTACATCCAGTATTTGATGGGCGT
AAATGGCGTTATTGTTGATCTAGTGGAGGAGATCTCAAATGCTGTGGCAGATTTCAGTAA
ACCAGTCCTCAATCAGAGCATGCTAGGGAGTGGTGTCGACTTGGTTGGAGCAAAGCATCA
GGCCTTCTCACAGCAGCAGCTGGGTTTCTTGCTCTGGCTTATACCTGAACTGATCCAGCA
ACCACACTGA

CDS

1269 bp

>Os08t0535700-00 Similar to glycerophosphodiester phosphodiesterase.
ATGGCGCTCCCGGCGGCGACGGCCCGCGCGGCGGCGCTGTGCCGGATCGCGGCGTGCGCG
TCGGCATCGTCGGCGGCGGCGGCGGCGACCGGGGGGAGGCGCGGGGCGGAGAAGCTGCCG
TTCTCGCTGGCGGAGCGGGGGATGGTGGTGGGGGGGCACCGCGGGATGGGGATGAACGCG
GTGGGGGCGCCGCCGGGGGCGCGGATCGAGGCGGTGAGGGAGCGGGAGAACACGCTGCTC
TCGTTCGGCCGTGCCGCCGCGCACGCCGCCGTCGCCTTCGTCGAGTTCGACGTCCAGGTT
ACAAAAGATGGCTGCCCAATAATCTTCCATGATGACTTCATCCTAACACAAGAAACTGAT
GCAGTCTATGCAAAGCGTGTTACTGATCTTCTCTTGGAAGAATTTCTTTCATATGGGCCG
CAAAAGAATTCCCATGAGGTGATTTACTCCTTTTTTTGTTGGCTTCTGCTGTGCCAAGTT
CATGGTTATGAATGCATTTTTGAGATGCCATTTTGTAAACTTGCCCTTATGTTGATTGTT
CAGATCTCCAAGCCATTGCTTAGACGGACCAGCGATGGTAGAGTTGTTAACTGGAGCGCA
AAAGATGATGATTCCCTATGCACATTGCAAGAAGTCTTTGAACGTGTCAGTCCTCGTCTA
GGATTTAACATTGAGCTAAAGTTTGATGATGACATCTTCTATGAAAGGAGTCAACTTGAC
CGTGCGCTTCAAGCTGTATTGCAAGTTGTTTCTCAGTATGCAAGCAATAGGCCTGTATTT
TTCTCAACCTTCCATCCTGATGCGGCAAGGATTATGAGGGAACTTCAGAGCTTATATCCT
GTACTCTTCTTAACAGAAGGAGGAACAGCTCAACACAAAGATTCAAGAAGGAACTCACTT
GATGAAGCTATCCGGGTCTGCCTAGAGTACGAGTTGCATGGACTTGTATCAGAGGTAAGA
GGGGTTTTAAAGAATCCCTCTGCAGTCCTTAGAGCAAAAGAGTCCAACCTTGCACTTCTG
ACCTATGGGCAGCTCAATAATGTGTGGGAGGCTGTGTACATCCAGTATTTGATGGGCGTA
AATGGCGTTATTGTTGATCTAGTGGAGGAGATCTCAAATGCTGTGGCAGATTTCAGTAAA
CCAGTCCTCAATCAGAGCATGCTAGGGAGTGGTGTCGACTTGGTTGGAGCAAAGCATCAG
GCCTTCTCACAGCAGCAGCTGGGTTTCTTGCTCTGGCTTATACCTGAACTGATCCAGCAA
CCACACTGA

Protein

423 aa

>Os08t0535700-00 Similar to glycerophosphodiester phosphodiesterase.
MALPAATARAAALCRIAACASASSAAAAATGGRRGAEKLPFSLAERGMVVGGHRGMGMNA
VGAPPGARIEAVRERENTLLSFGRAAAHAAVAFVEFDVQVTKDGCPIIFHDDFILTQETD
AVYAKRVTDLLLEEFLSYGPQKNSHEVIYSFFCWLLLCQVHGYECIFEMPFCKLALMLIV
QISKPLLRRTSDGRVVNWSAKDDDSLCTLQEVFERVSPRLGFNIELKFDDDIFYERSQLD
RALQAVLQVVSQYASNRPVFFSTFHPDAARIMRELQSLYPVLFLTEGGTAQHKDSRRNSL
DEAIRVCLEYELHGLVSEVRGVLKNPSAVLRAKESNLALLTYGQLNNVWEAVYIQYLMGV
NGVIVDLVEEISNAVADFSKPVLNQSMLGSGVDLVGAKHQAFSQQQLGFLLWLIPELIQQ
PH*

5'UTR

chr08:26751395..26751395 (+ strand) : 1 bp

CDS

chr08:26751396..26751692 (+ strand) : 297 bp

chr08:26752321..26752380 (+ strand) : 60 bp

chr08:26752493..26752879 (+ strand) : 387 bp

chr08:26752988..26753083 (+ strand) : 96 bp

chr08:26753721..26753917 (+ strand) : 197 bp

chr08:26754016..26754247 (+ strand) : 232 bp

FASTA

>Os08t0535700-00 class=Sequence position=chr08:26751395..26754247 (+ strand)
AATGGCGCTC CCGGCGGCGA CGGCCCGCGC GGCGGCGCTG TGCCGGATCG CGGCGTGCGC GTCGGCATCG TCGGCGGCGG
CGGCGGCGAC CGGGGGGAGG CGCGGGGCGG AGAAGCTGCC GTTCTCGCTG GCGGAGCGGG GGATGGTGGT GGGGGGGCAC
CGCGGGATGG GGATGAACGC GGTGGGGGCG CCGCCGGGGG CGCGGATCGA GGCGGTGAGG GAGCGGGAGA ACACGCTGCT
CTCGTTCGGC CGTGCCGCCG CGCACGCCGC CGTCGCCTTC GTCGAGTTCG ACGTCCAGGT ATATATATGC AGCGCAGCCG
AGTTCGACGT ACGTGCTTCC ATTTCCACGT TGTTGGTAGT ACCTGTGTTT GTTTTGGACT TTGAATTGGA TGTCAGTTTA
GGCTTTGGAT TGGTTGGTTT TGACACCGCA GCATCGCAAT GCAAGATTTG GAAGCTAGCG TGCGTATGAC TTGGATGTAG
CTACTGATTG GTGTGGTGCT GGACATGAAA TTTGCTAAGT ACACAAGTAT ATTGCAAGCA ATGTTCTAGC CAGGGAACTA
CATGGGACAA GCCTCACAAG TAGGAGTATC AATTTAATCG CATTTAACAA GGATCTAGAT GCCACCATGC TAAATTGGTC
AAGAATGAAG AATGGAGCGA TTTTAGGTGG ATGTTTTGCA GGGATGTAGC AGATATCCAT TAGGCAGGTG CTAGGATTTG
AAGTTGCAGT TCTTGTTTTG AGCTGCGGAC GTTCTTAATA CATTGCCAAC TACTCTTAGA TCATATTGCA TTGGTGAAAT
CAAGTCGTTG GCACTGGGCC AGCAATCAAT AGGATTCATT CTCTTCCAAT TTTTTTGATT GGTACAATTG ATTTCAGTTT
GAGCATACAG TTATCCTGAT GTACTGATTA CCCTTTTGCC TTGCAGGTTA CAAAAGATGG CTGCCCAATA ATCTTCCATG
ATGACTTCAT CCTAACACAA GAAACTGTAT GTTCCTTTCT GCTCATTCTC TTCATTGTTA TGCTCGGTTT ACGTGGTACC
CTGTTCATCT ATGGCAGGAA GAGCGCCTGA CTCTTGATTG TTCTTGCAAG ATGTGTAGGA TGCAGTCTAT GCAAAGCGTG
TTACTGATCT TCTCTTGGAA GAATTTCTTT CATATGGGCC GCAAAAGAAT TCCCATGAGG TGATTTACTC CTTTTTTTGT
TGGCTTCTGC TGTGCCAAGT TCATGGTTAT GAATGCATTT TTGAGATGCC ATTTTGTAAA CTTGCCCTTA TGTTGATTGT
TCAGATCTCC AAGCCATTGC TTAGACGGAC CAGCGATGGT AGAGTTGTTA ACTGGAGCGC AAAAGATGAT GATTCCCTAT
GCACATTGCA AGAAGTCTTT GAACGTGTCA GTCCTCGTCT AGGATTTAAC ATTGAGCTAA AGTTTGATGA TGACATCTTC
TATGAAAGGA GTCAACTTGA CCGTGCGCTT CAAGCTGTAT TGCAAGTATG GTTTGTTTCC TTTGTTCATG TAACACGATA
TCAATTAATT CACATCCAGT AATTTGGTCA CTGTGAGGTG ATGACCATAA CACCATCATA TGCTTTTTGA TAGGTTGTTT
CTCAGTATGC AAGCAATAGG CCTGTATTTT TCTCAACCTT CCATCCTGAT GCGGCAAGGA TTATGAGGGA ACTTCAGAGC
TTATATCCTG TAAGTATTAT TAGAAACCTC TCATATTACA TATATGAATT GTAAGGTCAA AATGTCAAAT GTTTCCTCAG
CATTTTAACT AGCTGTAATT TCGGTAGTTT CTTTGACACA AGTGAAGAAA AGAAAAAAAA TCTTACATTA GCAGGTCTGT
AACTTCCAAA CTGAATATCA AAACCTATAA ACCTTGTGCA GAACAATCAG GTTGCAAACT CGTGATGCAC TTGTATTTCA
GCCTTCTTAT TACACCATAT ATCTTTCGGG ATGTAGAGAC CGAGTTTTAT TTAATCCATT ATCTAAAAAA ATTACACCAT
ATATCTGGTA GTTACTTGGG AAAAAATGAT CATACGTAGA AGAAATTGAA GCACACCCAA TAATTTAAAC ACAGCAGACT
CTAAATACCT TCTTATGATG AGAAGTAGCC GATTACGAAT TTTCATTGAC CTGCAAAATG GATGAGAAAT GTATGTAAAT
GCAGACAGCT TCAGTGTAAA CCAATACTTT CTTATTTCTT TTAGACTGAC ATTTCTGATG TTAGATTGCA CGGTTTTATA
TCCAATCTGG ATGTGTAACC ATTAGCATTT AGTAAAACGT TGAATAGGTC TTATCATCAT CCTTATTTCT CGCACTCTTG
CATTAGGTAC TCTTCTTAAC AGAAGGAGGA ACAGCTCAAC ACAAAGATTC AAGAAGGAAC TCACTTGATG AAGCTATCCG
GGTCTGCCTA GAGTACGAGT TGCATGGACT TGTATCAGAG GTAAGAGGGG TTTTAAAGAA TCCCTCTGCA GTCCTTAGAG
CAAAAGAGTC CAACCTTGCA CTTCTGACCT ATGGGCAGCT CAAGTAAGCA GCATATTTGC CTAGTGTTCC TTCTGTTATG
TTGGCGCTGC TCTTTTTTTC CTCAATCATC TTTATTCGTG GGTTTGCTGG TGGATTTGCA GTAATGTGTG GGAGGCTGTG
TACATCCAGT ATTTGATGGG CGTAAATGGC GTTATTGTTG ATCTAGTGGA GGAGATCTCA AATGCTGTGG CAGATTTCAG
TAAACCAGTC CTCAATCAGA GCATGCTAGG GAGTGGTGTC GACTTGGTTG GAGCAAAGCA TCAGGCCTTC TCACAGCAGC
AGCTGGGTTT CTTGCTCTGG CTTATACCTG AACTGATCCA GCAACCACAC TGA

Locus: Os08g0535700

Loading...

Locus: Os08g0535700

Loading...