Os08t0535800-01

Locus

Os08g0535800

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC005, ONAC5, ONAC035, ONAC35, ONAC046, ONAC46, ONAC052, ONAC52

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 005, NAC domain-containing protein 5, NAC domain-containing protein 35, NAC domain-containing protein 46, NAC domain-containing protein 52

Transcript Evidence

AK067906 (DDBJ, Best hit)

Protein Evidence

NP_001151483.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013126H02 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0535800-01)

RiceXPro (AK067906)

Others

Oryzabase (11457)

KEGG (Os08t0535800-01)

Transcript

1451 bp

>Os08t0535800-01 No apical meristem (NAM) protein domain containing protein.
AGTGCTTGCCAATTCGGAGAAGGCATCGAGCTGAAGCCACAGGGCGATCGATGGAGGTGA
GGTGAGGAGGAAGAAGAAGACGAGATGGAGTTGGAGTGCACTTCACGCCACATGAGGGAG
ATGCTATAAAATCCCTTCTCCCTTTTCAATTTCACGCCAACACCCAACCCCCTCTCTCTC
TCTATCTCTCTCCTCTCTCTCTCTCTAGCTCTAGCTCTAGCTCGTCGCCGCCATGAACGT
TCCAAGCAAATGCATGGCTCCTGCAAAGTAAAAAAAGAAGAAGAAGCAGCAGCTGCAGCT
TCTCTTCAGTATCGATCTTTAACTGTATCGAGCTAGCTTAGCTTAGCTTAGCTCTCTGCC
ATTAACTTGTGCTTCACTGAGCTTGAGCTAGCTAGCTTCTTGGCTGTGTGACTGAGTAGC
TCTAGCTCCTCGTCGTCGTCGTCGTCGTCGTCGTCGTCGGCGTCGGTGGTGGTGTGAATT
GATAGAATTGATACGATGGAGAGGGCGGCTGCGGCGGCGCCGGTGGTGGTGAGGCATgga
ggagtggtgttgccgccggggttcaggttccacccgacggacgaggagctcgtggtgcag
tacctccgccgcaaggcgttcggcctgccgctccccgccgccgtcatccccgacctccac
aacctcttcaagctcgatccctgggacattcctgGTGCGAGCAGCGACGGGGACAAGTAC
TTCTTCGCCGTGCGGCCACCTGCGGCGAGGGGGAGGAGGCAGCATGTGACGGCGAGCGGT
GGGTGCTGGAAGCCGGCGGGCGGGCGGGACAAGCCGGTGGTGGTGGCCCGGTGCGGCGGG
AGCCACCTCGTCGGCGTCAAGAAGGGCATGGTGTTCGTCCCACGGCAAGGGAGGAAGGCA
CCGGCGGCGGCGGCGGCGGCCGCCGGCGGTGGCTGCTGGGTCATGCACGAGTACAGCCTC
GCCCTGCCGATGCACAAGAAGGGTTGCTTGGCTGAGGCTGAAGAATGGGTAGTGTGCCGG
ATATTTCAGAGGAGCAGCAGCGGCAGCCGGTCGCCGAGGAGGCCTGACAACGACGTGAGG
CGAACGATGCCGGCCGTCGCCGAGCTCGGCCGGTCGCCGTCGCCATCGTCGTCGTCGTCG
CAATCCAGCTGCGTCACAAGCAGCTCCGACCAGGAAGAGGTCAGCAGCGGCTAGCTAGCT
GAAGAAGAATGCAGGCAGCAGCAGCAAGCAGCTAAGCTGCCTCTCAAAGAGAGGCTTGAG
TGTTAGCCTAGCTAAGCATATATATTTATAGCCGGCCAAACCCTCTGAAAGTGATCTGCA
TCAATGCATGCCCCCCTTTAATTTCTTCTTCCTCCTTAATTATTTTTTCCCAACCATGTA
ATGTAATGTAATTTAATGTAATGCAGTGTAATGTAACGGGAAGGAAGCACTGAATTAATC
AAATTAAATTA

CDS

699 bp

>Os08t0535800-01 No apical meristem (NAM) protein domain containing protein.
ATGGAGAGGGCGGCTGCGGCGGCGCCGGTGGTGGTGAGGCATggaggagtggtgttgccg
ccggggttcaggttccacccgacggacgaggagctcgtggtgcagtacctccgccgcaag
gcgttcggcctgccgctccccgccgccgtcatccccgacctccacaacctcttcaagctc
gatccctgggacattcctgGTGCGAGCAGCGACGGGGACAAGTACTTCTTCGCCGTGCGG
CCACCTGCGGCGAGGGGGAGGAGGCAGCATGTGACGGCGAGCGGTGGGTGCTGGAAGCCG
GCGGGCGGGCGGGACAAGCCGGTGGTGGTGGCCCGGTGCGGCGGGAGCCACCTCGTCGGC
GTCAAGAAGGGCATGGTGTTCGTCCCACGGCAAGGGAGGAAGGCACCGGCGGCGGCGGCG
GCGGCCGCCGGCGGTGGCTGCTGGGTCATGCACGAGTACAGCCTCGCCCTGCCGATGCAC
AAGAAGGGTTGCTTGGCTGAGGCTGAAGAATGGGTAGTGTGCCGGATATTTCAGAGGAGC
AGCAGCGGCAGCCGGTCGCCGAGGAGGCCTGACAACGACGTGAGGCGAACGATGCCGGCC
GTCGCCGAGCTCGGCCGGTCGCCGTCGCCATCGTCGTCGTCGTCGCAATCCAGCTGCGTC
ACAAGCAGCTCCGACCAGGAAGAGGTCAGCAGCGGCTAG

Protein

233 aa

>Os08t0535800-01 No apical meristem (NAM) protein domain containing protein.
MERAAAAAPVVVRHGGVVLPPGFRFHPTDEELVVQYLRRKAFGLPLPAAVIPDLHNLFKL
DPWDIPGASSDGDKYFFAVRPPAARGRRQHVTASGGCWKPAGGRDKPVVVARCGGSHLVG
VKKGMVFVPRQGRKAPAAAAAAAGGGCWVMHEYSLALPMHKKGCLAEAEEWVVCRIFQRS
SSGSRSPRRPDNDVRRTMPAVAELGRSPSPSSSSSQSSCVTSSSDQEEVSSG*

5'UTR

chr08:26766816..26767310 (+ strand) : 495 bp

CDS

chr08:26767311..26767509 (+ strand) : 199 bp

chr08:26767591..26767877 (+ strand) : 287 bp

chr08:26769636..26769848 (+ strand) : 213 bp

3'UTR

chr08:26769849..26770105 (+ strand) : 257 bp

FASTA

>Os08t0535800-01 class=Sequence position=chr08:26766816..26770105 (+ strand)
AGTGCTTGCC AATTCGGAGA AGGCATCGAG CTGAAGCCAC AGGGCGATCG ATGGAGGTGA GGTGAGGAGG AAGAAGAAGA
CGAGATGGAG TTGGAGTGCA CTTCACGCCA CATGAGGGAG ATGCTATAAA ATCCCTTCTC CCTTTTCAAT TTCACGCCAA
CACCCAACCC CCTCTCTCTC TCTATCTCTC TCCTCTCTCT CTCTCTAGCT CTAGCTCTAG CTCGTCGCCG CCATGAACGT
TCCAAGCAAA TGCATGGCTC CTGCAAAGTA AAAAAAGAAG AAGAAGCAGC AGCTGCAGCT TCTCTTCAGT ATCGATCTTT
AACTGTATCG AGCTAGCTTA GCTTAGCTTA GCTCTCTGCC ATTAACTTGT GCTTCACTGA GCTTGAGCTA GCTAGCTTCT
TGGCTGTGTG ACTGAGTAGC TCTAGCTCCT CGTCGTCGTC GTCGTCGTCG TCGTCGTCGG CGTCGGTGGT GGTGTGAATT
GATAGAATTG ATACGATGGA GAGGGCGGCT GCGGCGGCGC CGGTGGTGGT GAGGCATgga ggagtggtgt tgccgccggg
gttcaggttc cacccgacgg acgaggagct cgtggtgcag tacctccgcc gcaaggcgtt cggcctgccg ctccccgccg
ccgtcatccc cgacctccac aacctcttca agctcgatcc ctgggacatt cctggtaCGA ATTCTTGACG ACGACGACGA
TGTCGAGATG GCACCATGAA TGCTTGTTGA TTGATTCGGT GTATGTGTGA TCCAGGTGCG AGCAGCGACG GGGACAAGTA
CTTCTTCGCC GTGCGGCCAC CTGCGGCGAG GGGGAGGAGG CAGCATGTGA CGGCGAGCGG TGGGTGCTGG AAGCCGGCGG
GCGGGCGGGA CAAGCCGGTG GTGGTGGCCC GGTGCGGCGG GAGCCACCTC GTCGGCGTCA AGAAGGGCAT GGTGTTCGTC
CCACGGCAAG GGAGGAAGGC ACCGGCGGCG GCGGCGGCGG CCGCCGGCGG TGGCTGCTGG GTCATGCACG AGTACAGCCT
CGCCCTGCCG ATGCACAAGA AGGTGAGAAA CCACTACTAA TCAATCATAT GAGCATATGA TTTCCTCCTT AATGATTGAT
TAATCACTCT CTTGATGACT AGTTGACTGC CAATTTGCCC ATTTCTTCAT GCAAGAACTG ATTGTGTTTG TTGATTGATT
TGTTTTCTTT CTTGATAAAT CTTCTTGTGT TTCTGCATGC ATGCAACTCA AGTGAGCAAG CTTGATAAAT CTTCTTGAGC
ATTAATTTGG GATCCAATAT TAAGCTCAAG CTAGCTTAGC TTAGCTTCTC AAAGTGCTAC TACTAGCTAA CTTGATCATA
TGTTTGCTTA TCACTATTTT TATTAGTTAT TTTTAAAATT ACTAGCTATA TGGCTTTCAA GATCATGTCA CATGCTCTCC
ATTAGCTTAA AGCTGTATAT TTGTCTTAAA TTACTAATTA GATAATTCTG ATAGCCACAG CATAGGTACA AATCAGTTAA
CCAGTCAAGT ACTATGCTAG AATTTGCCAA TAAATAAAAC AAAAAAAACC CAGTTCAACA CAAACTTCTC AGCCATAACT
AATTAACCGA GGAGCATCAT ACAAATTAAC ACATACAGGC AGGGTACAGT CTGCACATCA AACTGTCACA ACATGCTCAT
TAATAGTCAT GATCAACAAC AACAATAACT CGCAGTTTTA AATTGCTTCT GATGGTGGTT GCAATTCATC CTGACATGGA
GAGGTGGCTG TACTAGATGC TCTCTGCTCA TCAGATCGAA TCGTCTCATC AAGTTGTGCA GCTCCACTAC TACCAGTATC
TGCTAGTACT AGTACTACTA GCCACTCTCT TGCATATATG CAAGAACCAA CCAAACCAAC CCAGCAGCAT CCAATTAAGC
TGACAAACAA GTAGTACCTC AGGCTATTAA TCATGTTTGT TGGGATTACA TTAACTAATG CTTAATTAGC CAGAACAACA
GTGTTCCATG CCTGCTCCTG TGTCTGAACA AGCTGGGGCC TGTATATATT TCAATGCTGT CCAGTAGATC GACCAGTGCT
GTTGTGGCCA GTTCTGTGGC CACTGTTGAA GATATGTGCA GTAGATGTTC ATGCTCGTTT TGATTGAGAG AATCTTGAAA
TTAAAACACC TTGCTGGCAA TTAGTTTGAT TGACAAGCTG TACTTGAATG CTACATCTCG TATATCTACT TTTTTTTTTG
AAGAAAGATG CTTGAATGCC CTAGAATTCA TGTAGTTATA TTTTCTGAAG TTTGATCGTA AATACATATA TAAAACCATC
TGAACTTGTT ACATGAAAAT TATCATTGCA ATTGTCATTT AAAAAACTTT CATGATATTA ATTTTGCTAG TATATTTTAG
TGTAAAATTA ATTAAATTAG CCTGGATTAG TACATAGTGT AGTAGGAGTA GCTAGTACCA TTCCTTGCAA TATCACTACT
AATGCTAACA CTGTGTTTCA CTGCTGTTGC TAGAACAGAC TGAACAGTAG GATTTGCACT TGAATTTCAG CATATATTAA
AAATAAAGTA CAGAGGATAG AATTCCAGAA GAAAGACCAT AAATTTTGAA CAGTTTTTAG GTTGCTTAAG CTTGTGTGTC
CTTTGTAAAC AATGTGAAAA CTACAAAAGA GTATTTCAAG AAAAAAAAGG GAAAAATTAA AAAAAATGAG TACATGGACA
GAAACAACTG AAGTTTTCAA ACACAGCTAA AGCTGGAATG TTCTTAGATC GATGAAGCTG ACATATTTTT TTTTCTGATT
TGTGTGAACG ATCTCTGCAG GGTTGCTTGG CTGAGGCTGA AGAATGGGTA GTGTGCCGGA TATTTCAGAG GAGCAGCAGC
GGCAGCCGGT CGCCGAGGAG GCCTGACAAC GACGTGAGGC GAACGATGCC GGCCGTCGCC GAGCTCGGCC GGTCGCCGTC
GCCATCGTCG TCGTCGTCGC AATCCAGCTG CGTCACAAGC AGCTCCGACC AGGAAGAGGT CAGCAGCGGC TAGCTAGCTG
AAGAAGAATG CAGGCAGCAG CAGCAAGCAG CTAAGCTGCC TCTCAAAGAG AGGCTTGAGT GTTAGCCTAG CTAAGCATAT
ATATTTATAG CCGGCCAAAC CCTCTGAAAG TGATCTGCAT CAATGCATGC CCCCCTTTAA TTTCTTCTTC CTCCTTAATT
ATTTTTTCCC AACCATGTAA TGTAATGTAA TTTAATGTAA TGCAGTGTAA TGTAACGGGA AGGAAGCACT GAATTAATCA
AATTAAATTA 

Locus: Os08g0535800

Loading...

Locus: Os08g0535800

Loading...