Os08t0535800-02

Locus

Os08g0535800

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC005, ONAC5, ONAC035, ONAC35, ONAC046, ONAC46, ONAC052, ONAC52

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 005, NAC domain-containing protein 5, NAC domain-containing protein 35, NAC domain-containing protein 46, NAC domain-containing protein 52

Transcript Evidence

AK068776 (DDBJ, Best hit)

AK061543 (DDBJ, Best hit)

AK104766 (DDBJ, Best hit)

Protein Evidence

NP_001151483.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013160K11 (Online Clone Ordering)

006-311-A02 (Online Clone Ordering)

001-038-H11 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0535800-02)

Others

Oryzabase (11457)

Transcript

1523 bp

>Os08t0535800-02 No apical meristem (NAM) protein domain containing protein.
AACACCCAACCCCCTCTCTCTCTCTATCTCTCTCCTCTCTCTCTCTCTAGCTCTAGCTCT
AGCTCGTCGCCGCCATGAACGTTCCAAGCAAATGCATGGCTCCTGCAAAGTAAAAAAAGA
AGAAGAAGCAGCAGCTGCAGCTTCTCTTCAGTATCGATCTTTAACTGTATCGAGCTAGCT
TAGCTTAGCTTAGCTCTCTGCCATTAACTTGTGCTTCACTGAGCTTGAGCTAGCTAGCTT
CTTGGCTGTGTGACTGAGTAGCTCTAGCTCCTCGTCGTCGTCGTCGTCGTCGTCGTCGTC
GGCGTCGGTGGTGGTGTGAATTGATAGAATTGATACGATGGAGAGGGCGGCTGCGGCGGC
GCCGGTGGTGGTGAGGCATggaggagtggtgttgccgccggggttcaggttccacccgac
ggacgaggagctcgtggtgcagtacctccgccgcaaggcgttcggcctgccgctccccgc
cgccgtcatccccgacctccacaacctcttcaagctcgatccctgggacattcctgGTGC
GAGCAGCGACGGGGACAAGTACTTCTTCGCCGTGCGGCCACCTGCGGCGAGGGGGAGGAG
GCAGCATGTGACGGCGAGCGGTGGGTGCTGGAAGCCGGCGGGCGGGCGGGACAAGCCGGT
GGTGGTGGCCCGGTGCGGCGGGAGCCACCTCGTCGGCGTCAAGAAGGGCATGGTGTTCGT
CCCACGGCAAGGGAGGAAGGCACCGGCGGCGGCGGCGGCGGCCGCCGGCGGTGGCTGCTG
GGTCATGCACGAGTACAGCCTCGCCCTGCCGATGCACAAGAAGGGTTGCTTGGCTGAGGC
TGAAGAATGGGTAGTGTGCCGGATATTTCAGAGGAGCAGCAGCGGCAGCCGGTCGCCGAG
GAGGCCTGACAACGACGTGAGGCGAACGATGCCGGCCGTCGCCGAGCTCGGCCGGTCGCC
GTCGCCATCGTCGTCGTCGTCGCAATCCAGCTGCGTCACAAGCAGCTCCGACCAGGAAGA
GGTCAGCAGCGGCTAGCTAGCTGAAGAAGAATGCAGGCAGCAGCAGCAAGCAGCTAAGCT
GCCTCTCAAAGAGAGGCTTGAGTGTTAGCCTAGCTAAGCATATATATTTATAGCCGGCCA
AACCCTCTGAAAGTGATCTGCATCAATGCATGCCCCCCTTTAATTTCTTCTTCCTCCTTA
ATTATTTTTTCCCAACCATGTAATGTAATGTAATTTAATGTAATGCAGTGTAATGTAACG
GGAAGGAAGCACTGAATTAATCAAATTAAATTAACAAATGAAGAGTGCTCAAAAGTCCAA
GGAAGCTTCTAAGGTTCAGGAGCCAGATATTATCTACTTAATTAATTAATTATGGGCACA
TATCTGTAGTTGCTAGCTAGCTGCATATGCATCTCGTCGTTGTCGATCCATTTGTAACTT
GCAAGTTGTGTTGGTGTAATATTGTAATATTTTTCTCCGATGGTTGAGAAATTAATCTGA
AATCCATTATAGCAATTAATTGC

CDS

699 bp

>Os08t0535800-02 No apical meristem (NAM) protein domain containing protein.
ATGGAGAGGGCGGCTGCGGCGGCGCCGGTGGTGGTGAGGCATggaggagtggtgttgccg
ccggggttcaggttccacccgacggacgaggagctcgtggtgcagtacctccgccgcaag
gcgttcggcctgccgctccccgccgccgtcatccccgacctccacaacctcttcaagctc
gatccctgggacattcctgGTGCGAGCAGCGACGGGGACAAGTACTTCTTCGCCGTGCGG
CCACCTGCGGCGAGGGGGAGGAGGCAGCATGTGACGGCGAGCGGTGGGTGCTGGAAGCCG
GCGGGCGGGCGGGACAAGCCGGTGGTGGTGGCCCGGTGCGGCGGGAGCCACCTCGTCGGC
GTCAAGAAGGGCATGGTGTTCGTCCCACGGCAAGGGAGGAAGGCACCGGCGGCGGCGGCG
GCGGCCGCCGGCGGTGGCTGCTGGGTCATGCACGAGTACAGCCTCGCCCTGCCGATGCAC
AAGAAGGGTTGCTTGGCTGAGGCTGAAGAATGGGTAGTGTGCCGGATATTTCAGAGGAGC
AGCAGCGGCAGCCGGTCGCCGAGGAGGCCTGACAACGACGTGAGGCGAACGATGCCGGCC
GTCGCCGAGCTCGGCCGGTCGCCGTCGCCATCGTCGTCGTCGTCGCAATCCAGCTGCGTC
ACAAGCAGCTCCGACCAGGAAGAGGTCAGCAGCGGCTAG

Protein

233 aa

>Os08t0535800-02 No apical meristem (NAM) protein domain containing protein.
MERAAAAAPVVVRHGGVVLPPGFRFHPTDEELVVQYLRRKAFGLPLPAAVIPDLHNLFKL
DPWDIPGASSDGDKYFFAVRPPAARGRRQHVTASGGCWKPAGGRDKPVVVARCGGSHLVG
VKKGMVFVPRQGRKAPAAAAAAAGGGCWVMHEYSLALPMHKKGCLAEAEEWVVCRIFQRS
SSGSRSPRRPDNDVRRTMPAVAELGRSPSPSSSSSQSSCVTSSSDQEEVSSG*

5'UTR

chr08:26766974..26767310 (+ strand) : 337 bp

CDS

chr08:26767311..26767509 (+ strand) : 199 bp

chr08:26767591..26767877 (+ strand) : 287 bp

chr08:26769636..26769848 (+ strand) : 213 bp

3'UTR

chr08:26769849..26770335 (+ strand) : 487 bp

FASTA

>Os08t0535800-02 class=Sequence position=chr08:26766974..26770335 (+ strand)
AACACCCAAC CCCCTCTCTC TCTCTATCTC TCTCCTCTCT CTCTCTCTAG CTCTAGCTCT AGCTCGTCGC CGCCATGAAC
GTTCCAAGCA AATGCATGGC TCCTGCAAAG TAAAAAAAGA AGAAGAAGCA GCAGCTGCAG CTTCTCTTCA GTATCGATCT
TTAACTGTAT CGAGCTAGCT TAGCTTAGCT TAGCTCTCTG CCATTAACTT GTGCTTCACT GAGCTTGAGC TAGCTAGCTT
CTTGGCTGTG TGACTGAGTA GCTCTAGCTC CTCGTCGTCG TCGTCGTCGT CGTCGTCGTC GGCGTCGGTG GTGGTGTGAA
TTGATAGAAT TGATACGATG GAGAGGGCGG CTGCGGCGGC GCCGGTGGTG GTGAGGCATg gaggagtggt gttgccgccg
gggttcaggt tccacccgac ggacgaggag ctcgtggtgc agtacctccg ccgcaaggcg ttcggcctgc cgctccccgc
cgccgtcatc cccgacctcc acaacctctt caagctcgat ccctgggaca ttcctggtaC GAATTCTTGA CGACGACGAC
GATGTCGAGA TGGCACCATG AATGCTTGTT GATTGATTCG GTGTATGTGT GATCCAGGTG CGAGCAGCGA CGGGGACAAG
TACTTCTTCG CCGTGCGGCC ACCTGCGGCG AGGGGGAGGA GGCAGCATGT GACGGCGAGC GGTGGGTGCT GGAAGCCGGC
GGGCGGGCGG GACAAGCCGG TGGTGGTGGC CCGGTGCGGC GGGAGCCACC TCGTCGGCGT CAAGAAGGGC ATGGTGTTCG
TCCCACGGCA AGGGAGGAAG GCACCGGCGG CGGCGGCGGC GGCCGCCGGC GGTGGCTGCT GGGTCATGCA CGAGTACAGC
CTCGCCCTGC CGATGCACAA GAAGGTGAGA AACCACTACT AATCAATCAT ATGAGCATAT GATTTCCTCC TTAATGATTG
ATTAATCACT CTCTTGATGA CTAGTTGACT GCCAATTTGC CCATTTCTTC ATGCAAGAAC TGATTGTGTT TGTTGATTGA
TTTGTTTTCT TTCTTGATAA ATCTTCTTGT GTTTCTGCAT GCATGCAACT CAAGTGAGCA AGCTTGATAA ATCTTCTTGA
GCATTAATTT GGGATCCAAT ATTAAGCTCA AGCTAGCTTA GCTTAGCTTC TCAAAGTGCT ACTACTAGCT AACTTGATCA
TATGTTTGCT TATCACTATT TTTATTAGTT ATTTTTAAAA TTACTAGCTA TATGGCTTTC AAGATCATGT CACATGCTCT
CCATTAGCTT AAAGCTGTAT ATTTGTCTTA AATTACTAAT TAGATAATTC TGATAGCCAC AGCATAGGTA CAAATCAGTT
AACCAGTCAA GTACTATGCT AGAATTTGCC AATAAATAAA ACAAAAAAAA CCCAGTTCAA CACAAACTTC TCAGCCATAA
CTAATTAACC GAGGAGCATC ATACAAATTA ACACATACAG GCAGGGTACA GTCTGCACAT CAAACTGTCA CAACATGCTC
ATTAATAGTC ATGATCAACA ACAACAATAA CTCGCAGTTT TAAATTGCTT CTGATGGTGG TTGCAATTCA TCCTGACATG
GAGAGGTGGC TGTACTAGAT GCTCTCTGCT CATCAGATCG AATCGTCTCA TCAAGTTGTG CAGCTCCACT ACTACCAGTA
TCTGCTAGTA CTAGTACTAC TAGCCACTCT CTTGCATATA TGCAAGAACC AACCAAACCA ACCCAGCAGC ATCCAATTAA
GCTGACAAAC AAGTAGTACC TCAGGCTATT AATCATGTTT GTTGGGATTA CATTAACTAA TGCTTAATTA GCCAGAACAA
CAGTGTTCCA TGCCTGCTCC TGTGTCTGAA CAAGCTGGGG CCTGTATATA TTTCAATGCT GTCCAGTAGA TCGACCAGTG
CTGTTGTGGC CAGTTCTGTG GCCACTGTTG AAGATATGTG CAGTAGATGT TCATGCTCGT TTTGATTGAG AGAATCTTGA
AATTAAAACA CCTTGCTGGC AATTAGTTTG ATTGACAAGC TGTACTTGAA TGCTACATCT CGTATATCTA CTTTTTTTTT
TGAAGAAAGA TGCTTGAATG CCCTAGAATT CATGTAGTTA TATTTTCTGA AGTTTGATCG TAAATACATA TATAAAACCA
TCTGAACTTG TTACATGAAA ATTATCATTG CAATTGTCAT TTAAAAAACT TTCATGATAT TAATTTTGCT AGTATATTTT
AGTGTAAAAT TAATTAAATT AGCCTGGATT AGTACATAGT GTAGTAGGAG TAGCTAGTAC CATTCCTTGC AATATCACTA
CTAATGCTAA CACTGTGTTT CACTGCTGTT GCTAGAACAG ACTGAACAGT AGGATTTGCA CTTGAATTTC AGCATATATT
AAAAATAAAG TACAGAGGAT AGAATTCCAG AAGAAAGACC ATAAATTTTG AACAGTTTTT AGGTTGCTTA AGCTTGTGTG
TCCTTTGTAA ACAATGTGAA AACTACAAAA GAGTATTTCA AGAAAAAAAA GGGAAAAATT AAAAAAAATG AGTACATGGA
CAGAAACAAC TGAAGTTTTC AAACACAGCT AAAGCTGGAA TGTTCTTAGA TCGATGAAGC TGACATATTT TTTTTTCTGA
TTTGTGTGAA CGATCTCTGC AGGGTTGCTT GGCTGAGGCT GAAGAATGGG TAGTGTGCCG GATATTTCAG AGGAGCAGCA
GCGGCAGCCG GTCGCCGAGG AGGCCTGACA ACGACGTGAG GCGAACGATG CCGGCCGTCG CCGAGCTCGG CCGGTCGCCG
TCGCCATCGT CGTCGTCGTC GCAATCCAGC TGCGTCACAA GCAGCTCCGA CCAGGAAGAG GTCAGCAGCG GCTAGCTAGC
TGAAGAAGAA TGCAGGCAGC AGCAGCAAGC AGCTAAGCTG CCTCTCAAAG AGAGGCTTGA GTGTTAGCCT AGCTAAGCAT
ATATATTTAT AGCCGGCCAA ACCCTCTGAA AGTGATCTGC ATCAATGCAT GCCCCCCTTT AATTTCTTCT TCCTCCTTAA
TTATTTTTTC CCAACCATGT AATGTAATGT AATTTAATGT AATGCAGTGT AATGTAACGG GAAGGAAGCA CTGAATTAAT
CAAATTAAAT TAACAAATGA AGAGTGCTCA AAAGTCCAAG GAAGCTTCTA AGGTTCAGGA GCCAGATATT ATCTACTTAA
TTAATTAATT ATGGGCACAT ATCTGTAGTT GCTAGCTAGC TGCATATGCA TCTCGTCGTT GTCGATCCAT TTGTAACTTG
CAAGTTGTGT TGGTGTAATA TTGTAATATT TTTCTCCGAT GGTTGAGAAA TTAATCTGAA ATCCATTATA GCAATTAATT
GC

Locus: Os08g0535800

Loading...

Locus: Os08g0535800

Loading...