Os08t0537800-01

Locus

Os08g0537800

Description

Otubain-like protease with deubiquitination activity, Determination of grain size and shape

RAP-DB Gene Symbol Synonym(s)

WTG1, OsOTUB1

RAP-DB Gene Name Synonym(s)

WIDE AND THICK GRAIN 1

CGSNL Gene Symbol

WTG1

CGSNL Gene Name

WIDE AND THICK GRAIN 1

Oryzabase Gene Symbol Synonym(s)

OTUB1, OsOTUB1, OsOTUB1.1, OsOTUB1.2, qNPT1, OsWTG1

Oryzabase Gene Name Synonym(s)

new plant type 1, OTU domain-containing ubiquitin aldehyde-binding protein 1, wide and thick grain 1, otubain 1

Transcript Evidence

AK059388 (truncated)

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 28621888

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 10, 2017

Gene Ontology (GO)

Biological Process: protein deubiquitination (GO:0016579)

Molecular Function: hydrolase activity (GO:0016787)

Functional domain (InterPro)

Peptidase C65, otubain (IPR019400)

Ubiquitin thioesterase Otubain (IPR016615)

OTU domain (IPR003323)

Experimentally confirmed subcellular location

nucleus, cytoplasm

Full-length cDNA

001-026-H03(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os08t0537800-01)

RiceXPro (AK059388)

Others

Oryzabase (21850)

KEGG (Os08t0537800-01 (EC:3.4.19.12))

Transcript

1242 bp

>Os08t0537800-01 Otubain-like protease with deubiquitination activity, Determination of grain size and shape
CGGCGGTGGGGGAGGAGGTGGTGGAGGGTGCTCGGACTCCGTGTCGGTCGAGCTCTCGAT
GGGCGGGGACTACTACCACTCGTGCTGCGGCGACCCCGACCCCGACCTCCGCGCGCCCGA
GGGGCCCAAGCTGCCGTACGTCGGGGACAAGGAACCTCTCTCCACTTTAGCCGCCGAGTT
TCAGTCTGGCAGCCCCATTTTACAGGAGAAAATAAAGTTGCTTGGTGAACAGTATGATGC
TTTAAGAAGGACACGAGGAGATGGAAACTGCTTTTATCGAAGCTTTATGTTTTCCTACTT
GGAACATATCCTAGAGACACAAGACAAAGCTGAGGTTGAGCGCATTCTAAAAAAAATTGA
GCAGTGCAAGAAGACTCTTGCAGATCTTGGATACATTGAGTTCACCTTTGAAGATTTCTT
CTCTATATTCATTGATCAGCTGGAAAGTGTTCTGCAGGGACATGAATCCTCCATAGGGGC
CGAAGAGCTTCTAGAAAGAACCAGGGATCAGATGGTTTCTGATTATGTTGTCATGTTCTT
TAGGTTTGTCACCTCTGGTGAAATCCAAAGGAGGGCCGAGTTCTTCGAACCATTCATCTC
TGGCTTGACAAATTCGACTGTGGTTCAGTTCTGCAAGGCTTCCGTGGAGCCGATGGGCGA
GGAAAGTGACCATGTCCACATAATTGCCCTATCAGATGCGTTGGGTGTGCCAATCCGTGT
GATGTACCTAGACAGAAGCTCATGTGATGCTGGAAATATAAGTGTGAACCACCATGATTT
CAGCCCTGAGGCCAATTCATCGGACGGTGCTGCTGCTGCTGAGAAACCTTACATTACTTT
GCTCTACCGTCCTGGTCACTACGACATTCTCTACCCGAAGTGATTCTTGCCCGGTGAAGC
ATTGTTGGTTTTTTCCTCATGGCCAGTTTGAGAAATCGCTGTCTAGAACTCTGTAGTTAT
GGTGCTCGTGCATGCCACCAAAGGCCGGCCTTACAAAGAAAAGGACTTGTGCTCTTGGTC
TTGGGTGGTGAACTGGTGATCAAGGCATGCTTTGCTTGCCACTACCCAAATATCTCAGAT
CGGTAGTTTTTCCCTGCGTCAAGTCTACTCTGGTACAAACGATCTTGACATTGTGGTGTT
GACTGTTGAGAAGATTCTGTTGATACTGTTACTAATCCTCTCTTACTCACCTGCATCATA
AATTGATAGTGCATGCTTTGTCATGGCAACTAATTCCATTTT

CDS

825 bp

>Os08t0537800-01 Otubain-like protease with deubiquitination activity, Determination of grain size and shape
ATGGGCGGGGACTACTACCACTCGTGCTGCGGCGACCCCGACCCCGACCTCCGCGCGCCC
GAGGGGCCCAAGCTGCCGTACGTCGGGGACAAGGAACCTCTCTCCACTTTAGCCGCCGAG
TTTCAGTCTGGCAGCCCCATTTTACAGGAGAAAATAAAGTTGCTTGGTGAACAGTATGAT
GCTTTAAGAAGGACACGAGGAGATGGAAACTGCTTTTATCGAAGCTTTATGTTTTCCTAC
TTGGAACATATCCTAGAGACACAAGACAAAGCTGAGGTTGAGCGCATTCTAAAAAAAATT
GAGCAGTGCAAGAAGACTCTTGCAGATCTTGGATACATTGAGTTCACCTTTGAAGATTTC
TTCTCTATATTCATTGATCAGCTGGAAAGTGTTCTGCAGGGACATGAATCCTCCATAGGG
GCCGAAGAGCTTCTAGAAAGAACCAGGGATCAGATGGTTTCTGATTATGTTGTCATGTTC
TTTAGGTTTGTCACCTCTGGTGAAATCCAAAGGAGGGCCGAGTTCTTCGAACCATTCATC
TCTGGCTTGACAAATTCGACTGTGGTTCAGTTCTGCAAGGCTTCCGTGGAGCCGATGGGC
GAGGAAAGTGACCATGTCCACATAATTGCCCTATCAGATGCGTTGGGTGTGCCAATCCGT
GTGATGTACCTAGACAGAAGCTCATGTGATGCTGGAAATATAAGTGTGAACCACCATGAT
TTCAGCCCTGAGGCCAATTCATCGGACGGTGCTGCTGCTGCTGAGAAACCTTACATTACT
TTGCTCTACCGTCCTGGTCACTACGACATTCTCTACCCGAAGTGA

Protein

275 aa

>Os08t0537800-01 Otubain-like protease with deubiquitination activity, Determination of grain size and shape
MGGDYYHSCCGDPDPDLRAPEGPKLPYVGDKEPLSTLAAEFQSGSPILQEKIKLLGEQYD
ALRRTRGDGNCFYRSFMFSYLEHILETQDKAEVERILKKIEQCKKTLADLGYIEFTFEDF
FSIFIDQLESVLQGHESSIGAEELLERTRDQMVSDYVVMFFRFVTSGEIQRRAEFFEPFI
SGLTNSTVVQFCKASVEPMGEESDHVHIIALSDALGVPIRVMYLDRSSCDAGNISVNHHD
FSPEANSSDGAAAAEKPYITLLYRPGHYDILYPK*

5'UTR

chr08:26887305..26887362 (- strand) : 58 bp

CDS

chr08:26887212..26887304 (- strand) : 93 bp

chr08:26885950..26886015 (- strand) : 66 bp

chr08:26885756..26885839 (- strand) : 84 bp

chr08:26885560..26885682 (- strand) : 123 bp

chr08:26884862..26884914 (- strand) : 53 bp

chr08:26884655..26884704 (- strand) : 50 bp

chr08:26884482..26884582 (- strand) : 101 bp

chr08:26883485..26883739 (- strand) : 255 bp

3'UTR

chr08:26883126..26883484 (- strand) : 359 bp

FASTA

>Os08t0537800-01 class=Sequence position=chr08:26883126..26887362 (- strand)
CGGCGGTGGG GGAGGAGGTG GTGGAGGGTG CTCGGACTCC GTGTCGGTCG AGCTCTCGAT GGGCGGGGAC TACTACCACT
CGTGCTGCGG CGACCCCGAC CCCGACCTCC GCGCGCCCGA GGGGCCCAAG CTGCCGTACG TCGGGGACAA GGTGAGATGT
TGACGCCTCT CTCTCTCTGT CTCTCTCGCT CGCTTTGACT CATCTGCGCT TTGACTCATC TGCGGTCGAT AGATTTGTTC
ATGTGGTAGA AATGGGTCTG AATCGTGGTA AGACGCCCAG TGTTGCCATG CCAGTATCCG CTAGTTGTGC CAGCAGGTGA
GGCGATAGAT CAGTCCTGTT AGTCTAGTTG GATGCTGATT GTTGGTCATC ATTACTGTTG TATTGGTGCT CCATTTCTAT
GTGAATTGAC ATTTTAAGGC GTCTATACAA GCAGTGGGGA CTAGAATTTG GATAACAAGT AACAATTTCC CCTTATTGCG
TCATCTTAAA GGATAAGAGG AGTTATCAGA TGCTGGATTT TCTCCTTTAT TTTTAGTCGT GGTGCCTGGA ATAATGGAGA
TTGGCTGAAC AAGTTCATAT CAGTTGTGTC CATTTTCATC CTCTGGATGG TCAGTCCTTA AGTATTGTCA GGCGCTATTG
TTGGGAGCTG TAACTGTTGT ACTTGATTTT TTAGCTTCGT TGGTGAACTG ATGTTTGGAG GTTCATGCAG AAGTCAGAAC
CATGGGGAAT TAGAATTTGG ATGAACAGAC AGCAATTACC TTTCGTGTTC TCTTCTAGGA AAAGAAGGGT TTATCTGTTA
TCATTTGCTG GATGTGCTCC TTACTTAATA TTTATGCATG GAATAATAGA GATGGCCAAA CAAGTTTGCT CCATAGCGTA
TTATGATTCT AGGATAAAAG TGGTGTCATC CTTTAATCGT CACACCTAGG ACAATAAATG TGAAGGACGA ACTTGTTGAT
GCAGAATAAT AGCCTATGCT AGTCAATTCA GCACAGAAAC TGAGGTTAAA TGTGTCCCAA AAGTTTCAGT TAAGGTTCAC
ACTAGGATTT ACACGAACAG AACAAATCTG CAAATATAGG CCATATGAGA AGGTGGAGAG CTACATACAC ACAATTTCAT
ATGAAATGGA AAATGATGTT GGCACTAAAC TTGGATTTAG GTCAAGTAGT TAGATATTTG ATGCCTCAAA TTCATTTTGT
TCTGTTAATT GCAAGCACCT TTTCACAATG GAGGACACTA ATGCATTGCT ATGATTATCT CTGTGTTTGT ACAGTTATTT
TAGGCTATCG TATGACTTTC TTCTGCTTTC ATTTGTGTTC ATTATTGATA TCTTTTGAAC CTTGCAGGAA CCTCTCTCCA
CTTTAGCCGC CGAGTTTCAG TCTGGCAGCC CCATTTTACA GGAGAAAATA AAGGTCCATA TGGATTTGGC AGTTATAATA
TGTAATAGAC ATATTTTGGT TGATCTATCG TATCAATGGA TGGTGCTTCA ATTTGTTCTT ATAATTTCTT GCTTGGTCTG
CAGTTGCTTG GTGAACAGTA TGATGCTTTA AGAAGGACAC GAGGAGATGG AAACTGCTTT TATCGAAGCT TTATGTTTTC
CTACTTGGTA TTATTTTTGG TCTGTTTCCA TACAAACTTT GACTATTTTA TAAGCTGATG ATCTTATCAT TTGCTTCTAG
GAACATATCC TAGAGACACA AGACAAAGCT GAGGTTGAGC GCATTCTAAA AAAAATTGAG CAGTGCAAGA AGACTCTTGC
AGATCTTGGA TACATTGAGT TCACCTTTGA AGATTTCTTC TCTGTAAGTC TTTATTGTTA CTTTGTGTGG CCCTCCTTAC
TTATCCTGTT CAATTGCTGT TTTGCAACTT ATGCCAGATG TATTCCCTCT GAATAGTATG AAGATCTGTC CGATTATTTT
CATGTATGCT TGTTTGCATT TCCTTTTTAG ATGTTCCTGG AATAATTTTT GTATGAGCTA GTTATAATGA GAGCTTGTGC
ATTTTCCTGT CATGCAACAA ATTAAATACT AGTGTCTAAT CCTTGTGCAT TGTTAATAAC TTTGAAAATG ATTAGCCTTG
AAGATTGGTC CATTATATAT ATGTTCACTT GTTTCTTAGT TAGGATCACT CACCAGTCAC CCTTCTGAAG TTCATAATGT
ATCACTTATA AGTAAGCTAG CAAAACAAAA TTTGGACTGT TTGTAGCCAC CCAGAACCCA AATAGATGGA TTTCACATTA
TTTTCTACTG GCTTTGGGAG TTATTTGATC GATGCTAGTA CAACGTTGAA ATTTGGGTAG TTGAGATGCA TTTTTCACAA
AGGACTCCTT TATTGGTGCT TGATCTACAA CTGGTGTTTT ACTTTTTTAC AAAAAAATGT AATCTCCTTG CAGTGCACTC
AAATTATTGC AACCTCCTTC CTTATGTTCC CACCCTCATT ATTTTCAGAT ATTCATTGAT CAGCTGGAAA GTGTTCTGCA
GGGACATGAA TCCTCCATAG GGTAAATATC CTAGAGTTAT ATTTGTATCC TTAATGCATA TGACCAATAA TCATGTATTA
ACAACAAGCA ATTTTTGTAA TTGTTTATAA AGTATGGCAT GTCCATCATA AATGTTTTCC TTCTGTAGTG AATCTATTTT
GTTTTCCTGT ATCCTTAGGG CCGAAGAGCT TCTAGAAAGA ACCAGGGATC AGATGGTTTC TGATTATGGT TTGTACATCC
AGATATGTGT AGTATGCCTT TCTCTGCTTT GCTCTCATTA TTTAACTATG TCTTCTTTAG TTGTCATGTT CTTTAGGTTT
GTCACCTCTG GTGAAATCCA AAGGAGGGCC GAGTTCTTCG AACCATTCAT CTCTGGCTTG ACAAATTCGA CTGTGGTTCA
GGTTAGCTCC ATACTTCCAT TTTATGAGGG TTTGTACAGT CGTTGGGGAG GTATTATGAG GTACAATACC TCCAGGTACC
GGGAGTTACC ACACATAAGC ATAAAATGTG TGGTGCCTCT CCAAGGACCA CAAGAAATCT CTTCATTATA TTTGTAATGC
ACAGAGCAGA GAGTACAGAC AAATAGACCT GCACTCTGCA TTTTCATTAA GTATTTAGAT GTGAGATTAT TCTATGTTTT
ATCTCTCTTG TTAGTATTTT TTGCTCTGTT TTATAATGGA AGTTCATTTT CTTGGGAACT GTCATTCACA AAAAAATGAG
TTATCGTACC CTGCCATTTA GTAGGGAATT TGGTGGTAAA AAACCATTAA CTTTTTCTTC AATTTTGTGC CTTCTGCACA
AGGTGGGATA GGGCATATAT TGTGGAACAA AAGAGTGCAC AATGACTAAT TATTTAGTAT GCATCACACT GGAGTATGAT
ATACTAGTGG AAAGGTTATG GCAAAATACC ATGATAGTAG CTTGATAGAT TAGCAGGTCC GTAAGTATTT ATCCAATGAT
AATGTTTTAT TCATTAAACT GTAGCAGGAT AAAATCTACT TATGCACCTT TTTTTCATGA GTAGCAAACA ATGCATTCTC
TGGTTTGAAA AACTTGTTCA AGTTGCAGTG TGTTATTCCA ATCCGTGTTT GTGTGACAAG CAATTGCTGG AGTTACTGAT
CCTGAGTTCA ATTCAATTTG CAGTTCTGCA AGGCTTCCGT GGAGCCGATG GGCGAGGAAA GTGACCATGT CCACATAATT
GCCCTATCAG ATGCGTTGGG TGTGCCAATC CGTGTGATGT ACCTAGACAG AAGCTCATGT GATGCTGGAA ATATAAGTGT
GAACCACCAT GATTTCAGCC CTGAGGCCAA TTCATCGGAC GGTGCTGCTG CTGCTGAGAA ACCTTACATT ACTTTGCTCT
ACCGTCCTGG TCACTACGAC ATTCTCTACC CGAAGTGATT CTTGCCCGGT GAAGCATTGT TGGTTTTTTC CTCATGGCCA
GTTTGAGAAA TCGCTGTCTA GAACTCTGTA GTTATGGTGC TCGTGCATGC CACCAAAGGC CGGCCTTACA AAGAAAAGGA
CTTGTGCTCT TGGTCTTGGG TGGTGAACTG GTGATCAAGG CATGCTTTGC TTGCCACTAC CCAAATATCT CAGATCGGTA
GTTTTTCCCT GCGTCAAGTC TACTCTGGTA CAAACGATCT TGACATTGTG GTGTTGACTG TTGAGAAGAT TCTGTTGATA
CTGTTACTAA TCCTCTCTTA CTCACCTGCA TCATAAATTG ATAGTGCATG CTTTGTCATG GCAACTAATT CCATTTT