Os08t0544400-01

Locus

Os08g0544400

Description

A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance

RAP-DB Gene Symbol Synonym(s)

OsPDR1, OsPDR1.3, OsABCG45

RAP-DB Gene Name Synonym(s)

pleiotropic drug resistance 1

CGSNL Gene Symbol

PDR1

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 1

Oryzabase Gene Symbol Synonym(s)

OsABCG45, OsPDR1, FCO1

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 45, pleiotropic drug resistance 1, Functioning in Cesium Over-transport 1

Transcript Evidence

AK107688 (truncated)

XM_015794439

Protein Evidence

Q8GU82

Literature

PMID: 32771142

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

August 19, 2020

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC transporter-like (IPR003439)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

ATP-binding cassette transporter, PDR-like subfamily G, domain 2 (IPR034003)

ABC transporter, conserved site (IPR017871)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

002-132-B06(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os08t0544400-01)

RiceXPro (AK107688)

Others

Oryzabase (12018)

KEGG (Os08t0544400-01)

Transcript

4352 bp

>Os08t0544400-01 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
CTTTCGATccgatcgatcctcgtcggcggcgatggcggcggcggtggagctcactggtga
cggaggaaccacggcggagacgaggtggctgtcgccgccgctcacccacgacgacaaccg
cggcTTCCTCCAGATGCTCCGGGAGAAGAAGGAAAGGTTGGGGGTAGGGGCGGCGAAGGT
GGAGGTGAGGCTGGAGAAGCTGACGGTGGAGGCGGACGTGCGAGTCGGCCGCCGCGCCGT
GCCGACGCTGCTCAACTGCGCCATCAACGCCGCTCAGGAACTAGCAGCCTGTGCGCACAT
GTGCACCACAAGGAAAAAGCCCATGAAAATTATAAATGAAGCAACCGGAACGATTCGACC
ATCAAGGATGACACTTCTTCTCGGAGCACCTGGTTCAGGGAAAACAACCTTATTAAAAGC
ATTAGCAGGAAAGTTGGATTCTTCTCTGAAGATGAAAGGAAAGGTCACTTACAATGGAGA
AGAAGTGAATTCCTCGACACCTCAGTATCTACATGCTTATGTTAGCCAGTATGATCTTCA
CCATGCTGAAATGACAGTGAGAGAAACTATTGACTTCTCATCCAAGATGTTGGGAACTAA
TAATGAATTTGAGATGCTGGGAGAAGCAATTAGAAGAAAAAAAGGTGTCATCAATAGAGT
GGACCAAGAACTTGACTCTTTTATTAAGGCCACAACCTTTGGAGAAGGAAGCAACCTTAC
AACAAACTATATTATCAAGATACTTGGTTTATCCGAATGCGCTGATACCCTAGTGGGAGA
CGAGATGCGAAGAGGCATATCAGGAGGACAAAAGAAAAGAGCTACAATCGGCGAGATGCT
AGTTGGTCTTGCAAGATGCTTCTTCATGGATGATATATCAACTGGTCTAGATAGCTCCAC
CACATTTGAGATCATGAAGTTTCTGCAACAAATGGCTCACTTGATGGATCTCACAATGGT
TATTTCCTTGCTACAACCACCACCTGAGACATTGGAGTTATTTGATGACATAATCCTTTT
ATGTGAGGGGCAAATTGTGTACCATGGTCCTCGAGAAAATGCTACAGATTTCTTTGAAAC
TATGGGATTCAAATGCCCCAGCAGGAAGAATGTAGCAGATTTCCTTCAAGAGGTGACCTC
GAAGATGGACCAAAAACAATACTGGATAGGCAACGCAAATAAGTATCAATACCATTCAAT
TGAAAAATTTGCAGAGTCCTTCCGTACCTCGTACCTCCCAAGACTCGTAGAAAATGATCA
TTTTGAATCAACTAATGCCGGAAAGAGCAAGGAGGTAAAAACAAGCACAAGTCGCATGAT
CTCCAGCTGGAATATTTTCAAGGCATGCTTTTCAAGGGAAGTGCTGCTCCTAAAAAGAAA
CTCTCCAGTGCATATATTCAAGACCATACAGATAACTGTTCTCGCTTTAGTGATCTCAAC
TCTTTTTCTCCGGACAAATATGAGACATGATACTGTACTTGATGCCAATAAGTACATGGG
AGCACTCTTTATGGCTGTTGTCATAGTAAACTTCAATGGCATGACTGAAATTGCAATGAC
AATAAAGCGGCTCCCCATCTTCTACAAGCAAAGAGAAATACTAGCATTGCCAGGATGGGC
ACTCCTTTCTTCAGTATTCCTCCTTAGTCTGCCAATATCATTTGTAGAGACAGGTCTTTG
GACCGGCTTAACCTACTATGTGATCGGCTACGCACCTTCCTTTGTCAGATTTATCCAGCA
CTTTGTGGTACTTTTTGCCATGCATCAAATGTCAATGAGCCTGTATCGCTTCTTGGCAGC
CATAGGAAGAACACAAGTAATGGCTAATATGCTGGGGACTGCAGCTCTTATAGCAATCTA
CATACTTGGAGGCTTTGTCATATCAAAAGATAACCTCCAACCATGGCTGCGCTGGGGATA
TTGGACGTCCCCATTCACCTATGCACAGAATGCAGTTGCCCTGAATGAATTCCTTGACGA
CAGATGGGCTACAGAATTTCATTTCGCAAATGCAAATACTGTTGGTGAAACGATCCTCAA
GGTAAGGGGGCTGCTCACAGAGTGGCACTGGTACTGGATCTGTGTGAGCATTTTGTTTGG
ATTCTCGCTGGTCTTCAACATCCTCAGCATATTTGCACTACAATACATGAGATCTCCACA
CAAGCATCAAGTTAACATCAATGCCACAAAGGTGAAAGTAGACTACAACAGCCAGATAGT
TGGAAATGGCACGGCATCAACGGACCAAGTCATCCTCCCATTTCAGCCCCTCTCCCTTGT
ATTTGATCATATCAATTATTTTGTTGACATGCCTAAGGAGATGACAAAATATGGAGTAAC
AGATAAAAAGCTTCAGCTGCTACAAGATGTCAGTGGTGCTTTCAGGCCAGGGGTGCTAAC
AGCTCTGATGGGGATCACTGGTGCTGGAAAGACAACACTGCTCGATGTTTTGGCTGGAAG
AAAAACTGGAGGATACATTGAAGGAACTGTAAAAATAGCAGGCTACCCAAAGAAGCAGGA
GACATTCTCAAGGATCTCAGGCTACTGTGAACAGAGTGACATTCACTCCCCCAATCTCAC
CGTATATGAATCACTGCAGTTTTCTGCATGGCTTCGCCTTCCTTCAAATGTTAAATCTCA
CCAGAGaaatATGTTTATAGATGAAGTCATGGACCTAGTTGAGTTAACTGGACTGAAGAA
TGCCATGGTTGGCCTAGCAGGAGCGACAGGCCTGTCTGCTGAGCAGCGAAAAAGACTAAC
AATAGCTGTTGAGTTGGTAGCTAGTCCTTCCATTATATTTATGGATGAGCCAACCACTGG
TTTGGATGCTCGTGCTGCAGCAATTGTCATGAGAACAGTAAGAAAGACAGTAGACACTGG
ACGAACTGTTGTCTGCACAATTCATCAGCCAAGCATCGAGATATTTGAATCTTTTGACGA
GCTTCTACTTATGAAGAGAGGAGGTCAGCTCATATACAGTGGTTCATTAGGTCCCCTATC
TAGCAATATGATAAAGTATTTCGAGGCTATACCTGGTGTTCCTAGAATAAAAGAGGGGCA
AAACCCAGCAGCGTGGATGTTAGATATCAGTTCGCGCACAGCAGAATATGAGATTGGAGT
GGACTATGCAGAAATTTATCAGCGCTCATCCCTATACTGGGAGAACAGGCAACTAATTGA
TGACCTAGGAAAACCAGAACCAAACACAGAGGATCTACATTTTCCACCCAAATATTGGCA
AGACTTTAGGGCACAATGCATGGCATGCCTGTGGAAGCAAAATTGTGCTTATTGGAAAAA
TTCAGAACACAACGTTGTCCGATTCATAAACACATTTGCTGTGTCAATTATGTTTGGAAT
TGTATTCTGGAAAATTGGCTCAACCATtaaggatgagcaagatgtattcaacatACTAGG
GGTTGTGTATGGGTCAGCACTATTTCTGGGTTTCATGAACTGCAGCATCTTACAACCAGT
TGTAGGAATGGAAAGAGTTGTCCTCTACAGAGAGAAGGCGGCAGGCATGTACTCCACTAT
GGCGTACGCCATTGCTCAGGTGGCAGTTGAATTGCCTTACATGTTTGTCCAAGTATTCAT
CTTCTCAGCGATTGTGTACCCAATGATTGGGTTCCAAATGACTGCCACAAAGTTCTTTTG
GTTTGCCCTCTACATGGTGTTAAGTTTCCTGTACTACACGCTCTATGGGATGATGACAGT
AGCACTAACACCTAACATTGAGATAGCAGCTGGGTTGTCCTTCCTCATCTTCATCTTTTG
GAATGTCTTCTCTGGATTCATCATTGGAAGACAGatgatcccggtgtggtggagatgggt
gtattgggcaaacccggcggcatggacggtGTACGGGCTCATGTTCTCGCAGCTGGGAGA
CCGGACGGAGCTGATCCAGGTGCCAGGGCAGCCAGAGCAGACGGTGAAGGAGTTCCTGGA
GGGCTACCTCGGACTCCAGGACCGCTACTTCAACCTCGTCACCAGCCTGCACGTCGCCAT
CATCGCGCTCTTCACCTTCCTCTTCTTCCTCTCCATCAAGCACCTCAAGTTCCAGAGGCG
GTAGCACGGAATTGATGCGTGCAAACTGCAAATATACACTAATAACCAATCACTTAACTG
TACAAATGTAAGAGAACATAACAAAAATGCACAACATAAGGATTTGTTACTAAAATATGT
AAACCGTAAGGGATTTGCATGTGTAATAGCAGTATAGAATTGTTGTAGTACCATGGTCGA
GAAATATACAAAAGAAAGCAAGTGTATATGTTGGAAGAATTTGTAAAGATATAGTTTCGT
TCGCAGATTGATTGCAATGCAGACCGTGCCAA

CDS

4053 bp

>Os08t0544400-01 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
atggcggcggcggtggagctcactggtgacggaggaaccacggcggagacgaggtggctg
tcgccgccgctcacccacgacgacaaccgcggcTTCCTCCAGATGCTCCGGGAGAAGAAG
GAAAGGTTGGGGGTAGGGGCGGCGAAGGTGGAGGTGAGGCTGGAGAAGCTGACGGTGGAG
GCGGACGTGCGAGTCGGCCGCCGCGCCGTGCCGACGCTGCTCAACTGCGCCATCAACGCC
GCTCAGGAACTAGCAGCCTGTGCGCACATGTGCACCACAAGGAAAAAGCCCATGAAAATT
ATAAATGAAGCAACCGGAACGATTCGACCATCAAGGATGACACTTCTTCTCGGAGCACCT
GGTTCAGGGAAAACAACCTTATTAAAAGCATTAGCAGGAAAGTTGGATTCTTCTCTGAAG
ATGAAAGGAAAGGTCACTTACAATGGAGAAGAAGTGAATTCCTCGACACCTCAGTATCTA
CATGCTTATGTTAGCCAGTATGATCTTCACCATGCTGAAATGACAGTGAGAGAAACTATT
GACTTCTCATCCAAGATGTTGGGAACTAATAATGAATTTGAGATGCTGGGAGAAGCAATT
AGAAGAAAAAAAGGTGTCATCAATAGAGTGGACCAAGAACTTGACTCTTTTATTAAGGCC
ACAACCTTTGGAGAAGGAAGCAACCTTACAACAAACTATATTATCAAGATACTTGGTTTA
TCCGAATGCGCTGATACCCTAGTGGGAGACGAGATGCGAAGAGGCATATCAGGAGGACAA
AAGAAAAGAGCTACAATCGGCGAGATGCTAGTTGGTCTTGCAAGATGCTTCTTCATGGAT
GATATATCAACTGGTCTAGATAGCTCCACCACATTTGAGATCATGAAGTTTCTGCAACAA
ATGGCTCACTTGATGGATCTCACAATGGTTATTTCCTTGCTACAACCACCACCTGAGACA
TTGGAGTTATTTGATGACATAATCCTTTTATGTGAGGGGCAAATTGTGTACCATGGTCCT
CGAGAAAATGCTACAGATTTCTTTGAAACTATGGGATTCAAATGCCCCAGCAGGAAGAAT
GTAGCAGATTTCCTTCAAGAGGTGACCTCGAAGATGGACCAAAAACAATACTGGATAGGC
AACGCAAATAAGTATCAATACCATTCAATTGAAAAATTTGCAGAGTCCTTCCGTACCTCG
TACCTCCCAAGACTCGTAGAAAATGATCATTTTGAATCAACTAATGCCGGAAAGAGCAAG
GAGGTAAAAACAAGCACAAGTCGCATGATCTCCAGCTGGAATATTTTCAAGGCATGCTTT
TCAAGGGAAGTGCTGCTCCTAAAAAGAAACTCTCCAGTGCATATATTCAAGACCATACAG
ATAACTGTTCTCGCTTTAGTGATCTCAACTCTTTTTCTCCGGACAAATATGAGACATGAT
ACTGTACTTGATGCCAATAAGTACATGGGAGCACTCTTTATGGCTGTTGTCATAGTAAAC
TTCAATGGCATGACTGAAATTGCAATGACAATAAAGCGGCTCCCCATCTTCTACAAGCAA
AGAGAAATACTAGCATTGCCAGGATGGGCACTCCTTTCTTCAGTATTCCTCCTTAGTCTG
CCAATATCATTTGTAGAGACAGGTCTTTGGACCGGCTTAACCTACTATGTGATCGGCTAC
GCACCTTCCTTTGTCAGATTTATCCAGCACTTTGTGGTACTTTTTGCCATGCATCAAATG
TCAATGAGCCTGTATCGCTTCTTGGCAGCCATAGGAAGAACACAAGTAATGGCTAATATG
CTGGGGACTGCAGCTCTTATAGCAATCTACATACTTGGAGGCTTTGTCATATCAAAAGAT
AACCTCCAACCATGGCTGCGCTGGGGATATTGGACGTCCCCATTCACCTATGCACAGAAT
GCAGTTGCCCTGAATGAATTCCTTGACGACAGATGGGCTACAGAATTTCATTTCGCAAAT
GCAAATACTGTTGGTGAAACGATCCTCAAGGTAAGGGGGCTGCTCACAGAGTGGCACTGG
TACTGGATCTGTGTGAGCATTTTGTTTGGATTCTCGCTGGTCTTCAACATCCTCAGCATA
TTTGCACTACAATACATGAGATCTCCACACAAGCATCAAGTTAACATCAATGCCACAAAG
GTGAAAGTAGACTACAACAGCCAGATAGTTGGAAATGGCACGGCATCAACGGACCAAGTC
ATCCTCCCATTTCAGCCCCTCTCCCTTGTATTTGATCATATCAATTATTTTGTTGACATG
CCTAAGGAGATGACAAAATATGGAGTAACAGATAAAAAGCTTCAGCTGCTACAAGATGTC
AGTGGTGCTTTCAGGCCAGGGGTGCTAACAGCTCTGATGGGGATCACTGGTGCTGGAAAG
ACAACACTGCTCGATGTTTTGGCTGGAAGAAAAACTGGAGGATACATTGAAGGAACTGTA
AAAATAGCAGGCTACCCAAAGAAGCAGGAGACATTCTCAAGGATCTCAGGCTACTGTGAA
CAGAGTGACATTCACTCCCCCAATCTCACCGTATATGAATCACTGCAGTTTTCTGCATGG
CTTCGCCTTCCTTCAAATGTTAAATCTCACCAGAGaaatATGTTTATAGATGAAGTCATG
GACCTAGTTGAGTTAACTGGACTGAAGAATGCCATGGTTGGCCTAGCAGGAGCGACAGGC
CTGTCTGCTGAGCAGCGAAAAAGACTAACAATAGCTGTTGAGTTGGTAGCTAGTCCTTCC
ATTATATTTATGGATGAGCCAACCACTGGTTTGGATGCTCGTGCTGCAGCAATTGTCATG
AGAACAGTAAGAAAGACAGTAGACACTGGACGAACTGTTGTCTGCACAATTCATCAGCCA
AGCATCGAGATATTTGAATCTTTTGACGAGCTTCTACTTATGAAGAGAGGAGGTCAGCTC
ATATACAGTGGTTCATTAGGTCCCCTATCTAGCAATATGATAAAGTATTTCGAGGCTATA
CCTGGTGTTCCTAGAATAAAAGAGGGGCAAAACCCAGCAGCGTGGATGTTAGATATCAGT
TCGCGCACAGCAGAATATGAGATTGGAGTGGACTATGCAGAAATTTATCAGCGCTCATCC
CTATACTGGGAGAACAGGCAACTAATTGATGACCTAGGAAAACCAGAACCAAACACAGAG
GATCTACATTTTCCACCCAAATATTGGCAAGACTTTAGGGCACAATGCATGGCATGCCTG
TGGAAGCAAAATTGTGCTTATTGGAAAAATTCAGAACACAACGTTGTCCGATTCATAAAC
ACATTTGCTGTGTCAATTATGTTTGGAATTGTATTCTGGAAAATTGGCTCAACCATtaag
gatgagcaagatgtattcaacatACTAGGGGTTGTGTATGGGTCAGCACTATTTCTGGGT
TTCATGAACTGCAGCATCTTACAACCAGTTGTAGGAATGGAAAGAGTTGTCCTCTACAGA
GAGAAGGCGGCAGGCATGTACTCCACTATGGCGTACGCCATTGCTCAGGTGGCAGTTGAA
TTGCCTTACATGTTTGTCCAAGTATTCATCTTCTCAGCGATTGTGTACCCAATGATTGGG
TTCCAAATGACTGCCACAAAGTTCTTTTGGTTTGCCCTCTACATGGTGTTAAGTTTCCTG
TACTACACGCTCTATGGGATGATGACAGTAGCACTAACACCTAACATTGAGATAGCAGCT
GGGTTGTCCTTCCTCATCTTCATCTTTTGGAATGTCTTCTCTGGATTCATCATTGGAAGA
CAGatgatcccggtgtggtggagatgggtgtattgggcaaacccggcggcatggacggtG
TACGGGCTCATGTTCTCGCAGCTGGGAGACCGGACGGAGCTGATCCAGGTGCCAGGGCAG
CCAGAGCAGACGGTGAAGGAGTTCCTGGAGGGCTACCTCGGACTCCAGGACCGCTACTTC
AACCTCGTCACCAGCCTGCACGTCGCCATCATCGCGCTCTTCACCTTCCTCTTCTTCCTC
TCCATCAAGCACCTCAAGTTCCAGAGGCGGTAG

Protein

1350 aa

>Os08t0544400-01 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
MAAAVELTGDGGTTAETRWLSPPLTHDDNRGFLQMLREKKERLGVGAAKVEVRLEKLTVE
ADVRVGRRAVPTLLNCAINAAQELAACAHMCTTRKKPMKIINEATGTIRPSRMTLLLGAP
GSGKTTLLKALAGKLDSSLKMKGKVTYNGEEVNSSTPQYLHAYVSQYDLHHAEMTVRETI
DFSSKMLGTNNEFEMLGEAIRRKKGVINRVDQELDSFIKATTFGEGSNLTTNYIIKILGL
SECADTLVGDEMRRGISGGQKKRATIGEMLVGLARCFFMDDISTGLDSSTTFEIMKFLQQ
MAHLMDLTMVISLLQPPPETLELFDDIILLCEGQIVYHGPRENATDFFETMGFKCPSRKN
VADFLQEVTSKMDQKQYWIGNANKYQYHSIEKFAESFRTSYLPRLVENDHFESTNAGKSK
EVKTSTSRMISSWNIFKACFSREVLLLKRNSPVHIFKTIQITVLALVISTLFLRTNMRHD
TVLDANKYMGALFMAVVIVNFNGMTEIAMTIKRLPIFYKQREILALPGWALLSSVFLLSL
PISFVETGLWTGLTYYVIGYAPSFVRFIQHFVVLFAMHQMSMSLYRFLAAIGRTQVMANM
LGTAALIAIYILGGFVISKDNLQPWLRWGYWTSPFTYAQNAVALNEFLDDRWATEFHFAN
ANTVGETILKVRGLLTEWHWYWICVSILFGFSLVFNILSIFALQYMRSPHKHQVNINATK
VKVDYNSQIVGNGTASTDQVILPFQPLSLVFDHINYFVDMPKEMTKYGVTDKKLQLLQDV
SGAFRPGVLTALMGITGAGKTTLLDVLAGRKTGGYIEGTVKIAGYPKKQETFSRISGYCE
QSDIHSPNLTVYESLQFSAWLRLPSNVKSHQRNMFIDEVMDLVELTGLKNAMVGLAGATG
LSAEQRKRLTIAVELVASPSIIFMDEPTTGLDARAAAIVMRTVRKTVDTGRTVVCTIHQP
SIEIFESFDELLLMKRGGQLIYSGSLGPLSSNMIKYFEAIPGVPRIKEGQNPAAWMLDIS
SRTAEYEIGVDYAEIYQRSSLYWENRQLIDDLGKPEPNTEDLHFPPKYWQDFRAQCMACL
WKQNCAYWKNSEHNVVRFINTFAVSIMFGIVFWKIGSTIKDEQDVFNILGVVYGSALFLG
FMNCSILQPVVGMERVVLYREKAAGMYSTMAYAIAQVAVELPYMFVQVFIFSAIVYPMIG
FQMTATKFFWFALYMVLSFLYYTLYGMMTVALTPNIEIAAGLSFLIFIFWNVFSGFIIGR
QMIPVWWRWVYWANPAAWTVYGLMFSQLGDRTELIQVPGQPEQTVKEFLEGYLGLQDRYF
NLVTSLHVAIIALFTFLFFLSIKHLKFQRR*

5'UTR

chr08:27268052..27268082 (+ strand) : 31 bp

CDS

chr08:27268083..27268207 (+ strand) : 125 bp

chr08:27268368..27268488 (+ strand) : 121 bp

chr08:27270697..27270785 (+ strand) : 89 bp

chr08:27271018..27271102 (+ strand) : 85 bp

chr08:27271212..27271371 (+ strand) : 160 bp

chr08:27271567..27271643 (+ strand) : 77 bp

chr08:27271719..27271769 (+ strand) : 51 bp

chr08:27271838..27271928 (+ strand) : 91 bp

chr08:27272271..27272572 (+ strand) : 302 bp

chr08:27272761..27273356 (+ strand) : 596 bp

chr08:27273458..27273618 (+ strand) : 161 bp

chr08:27273731..27273834 (+ strand) : 104 bp

chr08:27273939..27274098 (+ strand) : 160 bp

chr08:27274184..27274347 (+ strand) : 164 bp

chr08:27274455..27274787 (+ strand) : 333 bp

chr08:27274882..27275172 (+ strand) : 291 bp

chr08:27275518..27275601 (+ strand) : 84 bp

chr08:27275672..27275805 (+ strand) : 134 bp

chr08:27275907..27276134 (+ strand) : 228 bp

chr08:27276235..27276406 (+ strand) : 172 bp

chr08:27276505..27276759 (+ strand) : 255 bp

chr08:27277020..27277289 (+ strand) : 270 bp

3'UTR

chr08:27277290..27277557 (+ strand) : 268 bp

FASTA

>Os08t0544400-01 class=Sequence position=chr08:27268052..27277557 (+ strand)
CTTTCGATcc gatcgatcct cgtcggcggc gatggcggcg gcggtggagc tcactggtga cggaggaacc acggcggaga
cgaggtggct gtcgccgccg ctcacccacg acgacaaccg cggcTTCCTC CAGATGCTCC GGGAGAAGAA GGAAAGGTAA
ATAGATGTAT GCATGCAACT ATATATGCAA GAATTGAATC AAGATGATCG ATCTTTTGCT TTCTTAGAAA AAAGAACTTG
TATATGCAAG ATCGATGGTT AATTCATCAG ATTGATGTAT GGATTATTGG CAATATATGT GTGTGTGGAT TTGCAGGTTG
GGGGTAGGGG CGGCGAAGGT GGAGGTGAGG CTGGAGAAGC TGACGGTGGA GGCGGACGTG CGAGTCGGCC GCCGCGCCGT
GCCGACGCTG CTCAACTGCG CCATCAACGC CGCTCAGGTA ATTAGCAGCA AATTCTTCCA GCCACTGTTG ATTTGTTACC
TTTCTTCTCC CTTAAACATA TCATCAACAT ATATTGTCTG CTGCATATGC ATGCCTTCTC GGCCTTTCGG TTTCTTTGTC
CAAGCCTGAA AGCGCTTTCG CTTTCGTCCT TTTCTTTCTC TTGCATGCAC ACGGATGACA TGGCATGCAT CGCAAATGTC
GAAAATGTCG AGAGAGATGA TAAAGAGTGA GATATGTGGT CTGCCACATA TAGAGAAGAG GTTGTGATCC GTAGATCAGT
TCAACTCCGA TCAAGTGCTT GGGCATTAAT TAGTGTGTGT GTGTGTGCCT GCCTCCTAAT TTTGGGTTGT TTGTTCATCC
GGAAAACCAG CTATTGGTTA GTCCATGGAC TCCTACTGGA AACCTAGCTA GTAGTAGCAC AAACATGCAT GCAGATGGAA
TGGTAGTAGA ATGAATCCAT AGCTTGCATG TGTTTAGTTA CACATACTTT GTGTTGGTAA TCGATTGAGA TAGTGACTTA
CTATAACTAG AACAAGGACA GTTGGGTGGC TATCCAACAA TAATATTTCG AGAATAACTA TGCCATAAAT CGGCATAAAC
CTGTCCTACA CACAACTGTT CTCTACTGTT TACTGAAAGC TAGTATAGTA GTTAGTTTGT CATGTAATCC AGTGTGGATC
TCGTAATTTT CGAGTGCATT TTTCCAAGTA TAAGAAGACA AAAACTTAAT TATCAAAAAT ATATCTGTTT CCATCTTATA
AGGCACTTTG TAATACACTA ATACTAGGCT GGATTAAATT AGGTGTTGGC CCATGATTTA GGTTAGTCTT ATTCTACTAT
CTATCACAAA ATTAAGATAG AGTAAGGTGG GATATATTAT GGCGTATATA ATAATTAAAT AATAGGCCAA TATATTCGTA
TAAATAGGGC TGCCCCCACC ATGTCTACCT CAAACAGAGA GCAATGACAT GGGCTTCTTT CACCCAACCG GCAACAGATC
ATTCATAAAT CCTGATGATA TTCCCAATAA CTAAGCCAGG TCAAATAATG CACGGTAATA AATTCAGAGG TATAGCAGTA
TATAGCACAG ATATCTAACC TGTCTTTTAC TCGAGCTAGA GCTCCAGCAG CCTGAACAGT GCATCGATGA CGACATCGGT
AGTGAAGATG ATGGCATCTG CATTAATCGT GGGCTTGTCG TTTGGCCCCG GGCTGTTGCT TGTTCCTTTC CCTGATGAGA
GAAAACAGAT CAGAGAACTG GGCACGCACG CCTCTTTTGG ATCATCCATA AACTAAATTC CAAGGTTTCA GATTCCGGTG
GTGCTGTTCA CCAGCTGCAG CTATTTATTA GCTACAGCAG ATACTCCATC TAAGAAAAGA GATCATAAGA CACTATACTT
ACCTGATAAT CTGATAGCCG GAATTATTCC AGATTTTCTT CCTGTTTGCA ATCGTGCCAA GTTTCTGGTG CAGCTATTGG
GAATGATTGG CGAATAGCCA AAATGCAGAT ATCTGACCAG ATATCCTAGA TCCTTGGAGG CATGTTTAAT CATATATGTC
GAGATTCTGA CAAGTATGTC AAGCTTGACT AGATCAGTTT AATGGCCCAG CACTGTTTTG ACCGCAGGCC TGCAGCTGTT
TGTCCCTTTT CTCTCCATGC ATGCATTTCA GAATTCAGAA ATCCTTATGA TCAGTTGATT TCTCCGGAGA GAAGTGATCC
TTTGGCAGTT TGGCAGGTCA ATTTTCTTTC GTTTTCAGAA AGTACAGCAC GTGCCAACGT GTCCAGTATA TCCCACGAAA
GCTCGCAACA CGTGTGTGCA TAGAGCCTGA ACACCGCGCG CCTAACATAG CCAAAATGAT CCCAGATTAC CTGCACATTA
GGTCAGGAGT TTGAAAAACT GTATTACAAA ACGACAAACA GATGAATTAC GTGCAAGCCA CAATACAAGA CAACGAAAAA
ATATCGAATA TATACCATGA GTCCATAGGT ACAAGTGCAG AACTACTTCT GGATTAGAAT GTGTGGAAAA ATAAAAGCGA
GTTGACACAG CATGTCTGTA TCTTAACACA GTATAAATTG AACGCACGCG TACGTAATCT CTTTCCAGGA CAAGATGGCA
GCGTCATTTG CTTTGCAACT ATGTTGTGAG TCGATTTAAA AGTCAAAACC ATCTTTCTGA AATAACATTT CAATTTGATA
TGCAGGAACT AGCAGCCTGT GCGCACATGT GCACCACAAG GAAAAAGCCC ATGAAAATTA TAAATGAAGC AACCGGAACG
ATTCGACCAT CAAGGTAAGC ATCGAGTACT ATTTACGACC GCAAGAGGTT AAGACAAATA CCAATTAAAC TGAAAATAAC
TGCTATCATT TTCTAAGAAA TTTGACTAAC TTCTTAAAAG TACAGAAACA GAAAGTTCAT TATTCACAAA TTTCAAATAA
AAAATGAATT ATGATCTATC ACTTTAATTA TTGCACTAAT TATCTTACCT GAGGTAATGA AATTTTGCAA CCCATTCTGC
AATCAGGATG ACACTTCTTC TCGGAGCACC TGGTTCAGGG AAAACAACCT TATTAAAAGC ATTAGCAGGA AAGTTGGATT
CTTCTCTGAA GGTAAAGTGA ATGTGAATTG TGTACATTCC ATTAAAAGTA TGTACTTAAC ATAATGCGTA GCATTGACTA
AACAATGCAT TTTCTTTCAT GATGTAACAT TTCTCAATAG ATGAAAGGAA AGGTCACTTA CAATGGAGAA GAAGTGAATT
CCTCGACACC TCAGTATCTA CATGCTTATG TTAGCCAGTA TGATCTTCAC CATGCTGAAA TGACAGTGAG AGAAACTATT
GACTTCTCAT CCAAGATGTT GGGAACTAAT AATGAATTTG GTAAGACAAC ATCTTCTGTA TGGCGTGTTA TTCAATTCAC
AAACAAGATA TGACTTTTGT GTACCCTATT CTATTTCACA ATTTAAAAGA CATTGGGTGC TGTAACTCAT GAAATTTTCA
TGGACGTACT TAAGGTATGT TAATTTTTGT ATGGCATAAA GACTAACTCA TTCCTGTTTG AAATGACCAC CTTAGAGATG
CTGGGAGAAG CAATTAGAAG AAAAAAAGGT GTCATCAATA GAGTGGACCA AGAACTTGAC TCTTTTATTA AGGTGGTTAA
CCTTTTTTTT TTGCATAAAA CTCATTTCTT ATTTAGTTAT CATCACTTAA AAAGCTGATT TGCACAGGCC ACAACCTTTG
GAGAAGGAAG CAACCTTACA ACAAACTATA TTATCAAGGT TAGTGTGTTG TTTGTTTGAT TCATTATTTA TCCTGAGGCA
CAGCCATAAA AATTGAGTGC ATGCAGATAC TTGGTTTATC CGAATGCGCT GATACCCTAG TGGGAGACGA GATGCGAAGA
GGCATATCAG GAGGACAAAA GAAAAGAGCT ACAATCGGTA AGCATTTTGT CTTTTTCTAC TATGTATTTT GTTTCTCTCG
TCATCCTCTA TTATCACTTC TCCAGTAAAT ATTTGTATCT TTTTCTACTA CGTTTTCTGC TCGTATCATC ATCCTCTATT
ACCACTTAAG AGTACATTCA ATTAGTCCGG TATAGGAAAG AAAACTTTTA TCATCTCAAC AACTTAATTA TTGTATGAAA
GAAAGAAAAG TAAAGTCCTT ATCATCGTAG AAATCTGCAT GGTAAAATGC TTCTAGCCAT CGAGCCAGAT GGCAGCAAGT
AAGCAGAGAA AGAGCAGGAC CAGATAAACG ACATACTTAC AGGTGCTTCG TTGATGCAGG CGAGATGCTA GTTGGTCTTG
CAAGATGCTT CTTCATGGAT GATATATCAA CTGGTCTAGA TAGCTCCACC ACATTTGAGA TCATGAAGTT TCTGCAACAA
ATGGCTCACT TGATGGATCT CACAATGGTT ATTTCCTTGC TACAACCACC ACCTGAGACA TTGGAGTTAT TTGATGACAT
AATCCTTTTA TGTGAGGGGC AAATTGTGTA CCATGGTCCT CGAGAAAATG CTACAGATTT CTTTGAAACT ATGGGATTCA
AATGCCCCAG CAGGAAGAAT GTAGCAGATT TCCTTCAAGA GGTACTCCAT TATCAATTAC TCCTATCATA AAGAAAAATT
GTCAAATAAA AACATTGCTA ACAGTTGATC TCCTTACAGA GCAACTTCAG GATAGCCACG TTTTTCTTGT GTTCCCAAAA
TCAATTATTC TCTAATAGGT ACTTGTGCAT AACAACATAA TACTAACAGT AACTTTCTCA TTTGGTCAGG TGACCTCGAA
GATGGACCAA AAACAATACT GGATAGGCAA CGCAAATAAG TATCAATACC ATTCAATTGA AAAATTTGCA GAGTCCTTCC
GTACCTCGTA CCTCCCAAGA CTCGTAGAAA ATGATCATTT TGAATCAACT AATGCCGGAA AGAGCAAGGA GGTAAAAACA
AGCACAAGTC GCATGATCTC CAGCTGGAAT ATTTTCAAGG CATGCTTTTC AAGGGAAGTG CTGCTCCTAA AAAGAAACTC
TCCAGTGCAT ATATTCAAGA CCATACAGAT AACTGTTCTC GCTTTAGTGA TCTCAACTCT TTTTCTCCGG ACAAATATGA
GACATGATAC TGTACTTGAT GCCAATAAGT ACATGGGAGC ACTCTTTATG GCTGTTGTCA TAGTAAACTT CAATGGCATG
ACTGAAATTG CAATGACAAT AAAGCGGCTC CCCATCTTCT ACAAGCAAAG AGAAATACTA GCATTGCCAG GATGGGCACT
CCTTTCTTCA GTATTCCTCC TTAGTCTGCC AATATCATTT GTAGAGACAG GTCTTTGGAC CGGCTTAACC TACTATGTGA
TCGGCTACGC ACCTTCCTTT GTCAGGTACT CCTCCTAGCA AGTTCTATAT TTAAACAATA AGGATAAGGA TTTTCTTACT
TGAATAGATT GAAGTAACAG GTGGAAGTTT CTCTTGCTTC TGACAGATTT ATCCAGCACT TTGTGGTACT TTTTGCCATG
CATCAAATGT CAATGAGCCT GTATCGCTTC TTGGCAGCCA TAGGAAGAAC ACAAGTAATG GCTAATATGC TGGGGACTGC
AGCTCTTATA GCAATCTACA TACTTGGAGG CTTTGTCATA TCAAAAGGTT AGACGATTTT GCTTAGAGTA CCTTGAAAAG
TATGGCAACT CTGTACTACA GGAAACAATT TAAGGCTTAT GTGCAGTAAT GATACTCACC AGTTTGTACA CTTGTCCAGA
TAACCTCCAA CCATGGCTGC GCTGGGGATA TTGGACGTCC CCATTCACCT ATGCACAGAA TGCAGTTGCC CTGAATGAAT
TCCTTGACGA CAGATGGGCT ACAGTAAGAA CTCATTTCAA CACTTGAGAT AGCTAACCAA AAAGTAGAGT AAAATTCTTG
ATCAAAGCTG TTTAAAAATT CCTAATGATG ATGATCTCTG CTTATAGGAA TTTCATTTCG CAAATGCAAA TACTGTTGGT
GAAACGATCC TCAAGGTAAG GGGGCTGCTC ACAGAGTGGC ACTGGTACTG GATCTGTGTG AGCATTTTGT TTGGATTCTC
GCTGGTCTTC AACATCCTCA GCATATTTGC ACTACAATAC ATGAGATGTA TGTACGCCAA GCTACACTAA GCCTCATAGA
TACTGAAATA GAAATACAAA TGGTACTCAC TCTTGTTGGT TATCATATGC AGCTCCACAC AAGCATCAAG TTAACATCAA
TGCCACAAAG GTGAAAGTAG ACTACAACAG CCAGATAGTT GGAAATGGCA CGGCATCAAC GGACCAAGTC ATCCTCCCAT
TTCAGCCCCT CTCCCTTGTA TTTGATCATA TCAATTATTT TGTTGACATG CCTAAGGTAA GATCTTGACC ACATCAGACA
TTACCAAATA GTTTAATCAT GTTAACCACA TCCAATCTGT TGCTCCACTC TTGATCTTAA TCAACTGTGA ATATCTTTGA
CAGGAGATGA CAAAATATGG AGTAACAGAT AAAAAGCTTC AGCTGCTACA AGATGTCAGT GGTGCTTTCA GGCCAGGGGT
GCTAACAGCT CTGATGGGGA TCACTGGTGC TGGAAAGACA ACACTGCTCG ATGTTTTGGC TGGAAGAAAA ACTGGAGGAT
ACATTGAAGG AACTGTAAAA ATAGCAGGCT ACCCAAAGAA GCAGGAGACA TTCTCAAGGA TCTCAGGCTA CTGTGAACAG
AGTGACATTC ACTCCCCCAA TCTCACCGTA TATGAATCAC TGCAGTTTTC TGCATGGCTT CGCCTTCCTT CAAATGTTAA
ATCTCACCAG AGaaatgtat gtgcattgac ctcttgtcct ttttctcaca tagttggaag ctcacatcaa acataggatc
tcatgatatt tatgttcaAA CATATTTCAG ATGTTTATAG ATGAAGTCAT GGACCTAGTT GAGTTAACTG GACTGAAGAA
TGCCATGGTT GGCCTAGCAG GAGCGACAGG CCTGTCTGCT GAGCAGCGAA AAAGACTAAC AATAGCTGTT GAGTTGGTAG
CTAGTCCTTC CATTATATTT ATGGATGAGC CAACCACTGG TTTGGATGCT CGTGCTGCAG CAATTGTCAT GAGAACAGTA
AGAAAGACAG TAGACACTGG ACGAACTGTT GTCTGCACAA TTCATCAGCC AAGCATCGAG ATATTTGAAT CTTTTGACGA
GGTATGAGTA AGTCAATAAA TGAGTCAAAA ATATTTTCCA CTACAAAATC AAGAAAGAAT AGTCCAGTAG TGGCAGGTGA
ATGACTGAAC GATAATTGAA AGCACAGCAC CAAAAGTAGT GCTTTTTGTC AAATCAAACA GCAAAACTAA TTGACTTCAC
ATTTATGCTC CCCTTTCTTC AATAGTAGCA CACATTAAAA TGTTCTTTTA ACACAAGCAA Ccattaaagt gttaaagata
gttgtgacaa gtagaatatt tcaggaacca cagctcaatt tacctttcct atgaacaagt acataggtcg tccttctGAA
TTTGAGTTCA ATCTTATTGA TCGCAGCTTC TACTTATGAA GAGAGGAGGT CAGCTCATAT ACAGTGGTTC ATTAGGTCCC
CTATCTAGCA ATATGATAAA GTATTTCGAG GTAAGATTAC CTAAGATTGG GTTCTTGTTC CAAAATGGAG AGAAGAGGTC
TTAAAATTCT TTTGTCGCAG GCTATACCTG GTGTTCCTAG AATAAAAGAG GGGCAAAACC CAGCAGCGTG GATGTTAGAT
ATCAGTTCGC GCACAGCAGA ATATGAGATT GGAGTGGACT ATGCAGAAAT TTATCAGCGC TCATCCCTAT ACTGGTAACG
CAATACGATC ATAAAGCAAA AATTACTATT TTGCTAACTT GTTTGAACAA GAAGGAAAAG GATAAACATG ATGAAATCAC
ACATGGTTTC TTCAGGGAGA ACAGGCAACT AATTGATGAC CTAGGAAAAC CAGAACCAAA CACAGAGGAT CTACATTTTC
CACCCAAATA TTGGCAAGAC TTTAGGGCAC AATGCATGGC ATGCCTGTGG AAGCAAAATT GTGCTTATTG GAAAAATTCA
GAACACAACG TTGTCCGATT CATAAACACA TTTGCTGTGT CAATTATGTT TGGAATTGTA TTCTGGAAAA TTGGCTCAAC
CATGTAAGTA CGAATAGCTA TCCAAATATT TTTATTTCAT GAGAACTTGT AGTGCTTCAA TATTGTTTTG GTTAAATGCT
AACTTTGttc tcctgtgcaa cagtaaggat gagcaagatg tattcaacat ACTAGGGGTT GTGTATGGGT CAGCACTATT
TCTGGGTTTC ATGAACTGCA GCATCTTACA ACCAGTTGTA GGAATGGAAA GAGTTGTCCT CTACAGAGAG AAGGCGGCAG
GCATGTACTC CACTATGGCG TACGCCATTG CTCAGGTAAT TAATATATAG ATCTGTATAA AAAAAACAAC TATTCTGAAA
AATAGAGGAT TTGAAATGGA CTCTAAACAC AAATGCTGGA TTCTTGTGTG CAGGTGGCAG TTGAATTGCC TTACATGTTT
GTCCAAGTAT TCATCTTCTC AGCGATTGTG TACCCAATGA TTGGGTTCCA AATGACTGCC ACAAAGTTCT TTTGGTTTGC
CCTCTACATG GTGTTAAGTT TCCTGTACTA CACGCTCTAT GGGATGATGA CAGTAGCACT AACACCTAAC ATTGAGATAG
CAGCTGGGTT GTCCTTCCTC ATCTTCATCT TTTGGAATGT CTTCTCTGGA TTCATCATTG GAAGACAGGT ACTACTACCC
TGCTACTCTG TTGTTTCAAG TCCCCAATTT TTGTCAAAAC CTTAAATTTA GGTTCTACTA GGGAGGATAA ATCTAAAATT
CTCAGACCTC TTCCTAACAA AATTGATAAA AAGTTTACCC TTGATAACCC CACAACTTCA TAATCAGAGA TCGTGTCTTA
GATTTCGTTT TGAACATTTG TGTGTGCTTG CGAAGAAAAG AAAATTTGTA TGTTTGACTA ACCTGATGAA CAACAACAAA
tgatgcagat gatcccggtg tggtggagat gggtgtattg ggcaaacccg gcggcatgga cggtGTACGG GCTCATGTTC
TCGCAGCTGG GAGACCGGAC GGAGCTGATC CAGGTGCCAG GGCAGCCAGA GCAGACGGTG AAGGAGTTCC TGGAGGGCTA
CCTCGGACTC CAGGACCGCT ACTTCAACCT CGTCACCAGC CTGCACGTCG CCATCATCGC GCTCTTCACC TTCCTCTTCT
TCCTCTCCAT CAAGCACCTC AAGTTCCAGA GGCGGTAGCA CGGAATTGAT GCGTGCAAAC TGCAAATATA CACTAATAAC
CAATCACTTA ACTGTACAAA TGTAAGAGAA CATAACAAAA ATGCACAACA TAAGGATTTG TTACTAAAAT ATGTAAACCG
TAAGGGATTT GCATGTGTAA TAGCAGTATA GAATTGTTGT AGTACCATGG TCGAGAAATA TACAAAAGAA AGCAAGTGTA
TATGTTGGAA GAATTTGTAA AGATATAGTT TCGTTCGCAG ATTGATTGCA ATGCAGACCG TGCCAA

Locus: Os08g0544400

Loading...

Locus: Os08g0544400

Loading...