Os08t0544400-03

Locus

Os08g0544400

Description

A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance

RAP-DB Gene Symbol Synonym(s)

OsPDR1, OsPDR1.1, OsABCG45

RAP-DB Gene Name Synonym(s)

pleiotropic drug resistance 1

CGSNL Gene Symbol

PDR1

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 1

Oryzabase Gene Symbol Synonym(s)

OsABCG45, OsPDR1, FCO1

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 45, pleiotropic drug resistance 1, Functioning in Cesium Over-transport 1

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 32771142

Note

Manual Curation

August 19, 2020

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC transporter-like (IPR003439)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

ATP-binding cassette transporter, PDR-like subfamily G, domain 2 (IPR034003)

ABC transporter, conserved site (IPR017871)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Others

Oryzabase (12018)

Transcript

4226 bp

>Os08t0544400-03 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
atggcggcggcggtggagctcactggtgacggaggaaccacggcggagacgaggtggctg
tcgccgccgctcacccacgacgacaaccgcggcTTCCTCCAGATGCTCCGGGAGAAGAAG
GAAAGGTTGGGGGTAGGGGCGGCGAAGGTGGAGGTGAGGCTGGAGAAGCTGACGGTGGAG
GCGGACGTGCGAGTCGGCCGCCGCGCCGTGCCGACGCTGCTCAACTGCGCCATCAACGCC
GCTCAGGAACTAGCAGCCTGTGCGCACATGTGCACCACAAGGAAAAAGCCCATGAAAATT
ATAAATGAAGCAACCGGAACGATTCGACCATCAAGGATGACACTTCTTCTCGGAGCACCT
GGTTCAGGGAAAACAACCTTATTAAAAGCATTAGCAGGAAAGTTGGATTCTTCTCTGAAG
ATGAAAGGAAAGGTCACTTACAATGGAGAAGAAGTGAATTCCTCGACACCTCAGTATCTA
CATGCTTATGTTAGCCAGTATGATCTTCACCATGCTGAAATGACATTATCATCACTTAAA
AAGCTGATTTGCACAGGCCACAACCTTTGGAGAAGGAAGCAACCTTACAACAAACTATAT
TATCAAGCCATAAAAATTGAGTGCATGCAGATACTTGGTTTATCCGAATGCGCTGATACC
CTAGTGGGAGACGAGATGCGAAGAGGCATATCAGGAGGACAAAAGAAAAGAGCTACAATC
GGCGAGATGCTAGTTGGTCTTGCAAGATGCTTCTTCATGGATGATATATCAACTGGTCTA
GATAGCTCCACCACATTTGAGATCATGAAGTTTCTGCAACAAATGGCTCACTTGATGGAT
CTCACAATGGTTATTTCCTTGCTACAACCACCACCTGAGACATTGGAGTTATTTGATGAC
ATAATCCTTTTATGTGAGGGGCAAATTGTGTACCATGGTCCTCGAGAAAATGCTACAGAT
TTCTTTGAAACTATGGGATTCAAATGCCCCAGCAGGAAGAATGTAGCAGATTTCCTTCAA
GAGGTGACCTCGAAGATGGACCAAAAACAATACTGGATAGGCAACGCAAATAAGTATCAA
TACCATTCAATTGAAAAATTTGCAGAGTCCTTCCGTACCTCGTACCTCCCAAGACTCGTA
GAAAATGATCATTTTGAATCAACTAATGCCGGAAAGAGCAAGGAGGTAAAAACAAGCACA
AGTCGCATGATCTCCAGCTGGAATATTTTCAAGGCATGCTTTTCAAGGGAAGTGCTGCTC
CTAAAAAGAAACTCTCCAGTGCATATATTCAAGACCATACAGATAACTGTTCTCGCTTTA
GTGATCTCAACTCTTTTTCTCCGGACAAATATGAGACATGATACTGTACTTGATGCCAAT
AAGTACATGGGAGCACTCTTTATGGCTGTTGTCATAGTAAACTTCAATGGCATGACTGAA
ATTGCAATGACAATAAAGCGGCTCCCCATCTTCTACAAGCAAAGAGAAATACTAGCATTG
CCAGGATGGGCACTCCTTTCTTCAGTATTCCTCCTTAGTCTGCCAATATCATTTGTAGAG
ACAGGTCTTTGGACCGGCTTAACCTACTATGTGATCGGCTACGCACCTTCCTTTGTCAGA
TTTATCCAGCACTTTGTGGTACTTTTTGCCATGCATCAAATGTCAATGAGCCTGTATCGC
TTCTTGGCAGCCATAGGAAGAACACAAGTAATGGCTAATATGCTGGGGACTGCAGCTCTT
ATAGCAATCTACATACTTGGAGGCTTTGTCATATCAAAAGATAACCTCCAACCATGGCTG
CGCTGGGGATATTGGACGTCCCCATTCACCTATGCACAGAATGCAGTTGCCCTGAATGAA
TTCCTTGACGACAGATGGGCTACAGAATTTCATTTCGCAAATGCAAATACTGTTGGTGAA
ACGATCCTCAAGGTAAGGGGGCTGCTCACAGAGTGGCACTGGTACTGGATCTGTGTGAGC
ATTTTGTTTGGATTCTCGCTGGTCTTCAACATCCTCAGCATATTTGCACTACAATACATG
AGATCTCCACACAAGCATCAAGTTAACATCAATGCCACAAAGGTGAAAGTAGACTACAAC
AGCCAGATAGTTGGAAATGGCACGGCATCAACGGACCAAGTCATCCTCCCATTTCAGCCC
CTCTCCCTTGTATTTGATCATATCAATTATTTTGTTGACATGCCTAAGGAGATGACAAAA
TATGGAGTAACAGATAAAAAGCTTCAGCTGCTACAAGATGTCAGTGGTGCTTTCAGGCCA
GGGGTGCTAACAGCTCTGATGGGGATCACTGGTGCTGGAAAGACAACACTGCTCGATGTT
TTGGCTGGAAGAAAAACTGGAGGATACATTGAAGGAACTGTAAAAATAGCAGGCTACCCA
AAGAAGCAGGAGACATTCTCAAGGATCTCAGGCTACTGTGAACAGAGTGACATTCACTCC
CCCAATCTCACCGTATATGAATCACTGCAGTTTTCTGCATGGCTTCGCCTTCCTTCAAAT
GTTAAATCTCACCAGAGaaatATGTTTATAGATGAAGTCATGGACCTAGTTGAGTTAACT
GGACTGAAGAATGCCATGGTTGGCCTAGCAGGAGCGACAGGCCTGTCTGCTGAGCAGCGA
AAAAGACTAACAATAGCTGTTGAGTTGGTAGCTAGTCCTTCCATTATATTTATGGATGAG
CCAACCACTGGTTTGGATGCTCGTGCTGCAGCAATTGTCATGAGAACAGTAAGAAAGACA
GTAGACACTGGACGAACTGTTGTCTGCACAATTCATCAGCCAAGCATCGAGATATTTGAA
TCTTTTGACGAGCTTCTACTTATGAAGAGAGGAGGTCAGCTCATATACAGTGGTTCATTA
GGTCCCCTATCTAGCAATATGATAAAGTATTTCGAGGCTATACCTGGTGTTCCTAGAATA
AAAGAGGGGCAAAACCCAGCAGCGTGGATGTTAGATATCAGTTCGCGCACAGCAGAATAT
GAGATTGGAGTGGACTATGCAGAAATTTATCAGCGCTCATCCCTATACTGGGAGAACAGG
CAACTAATTGATGACCTAGGAAAACCAGAACCAAACACAGAGGATCTACATTTTCCACCC
AAATATTGGCAAGACTTTAGGGCACAATGCATGGCATGCCTGTGGAAGCAAAATTGTGCT
TATTGGAAAAATTCAGAACACAACGTTGTCCGATTCATAAACACATTTGCTGTGTCAATT
ATGTTTGGAATTGTATTCTGGAAAATTGGCTCAACCATtaaggatgagcaagatgtattc
aacatACTAGGGGTTGTGTATGGGTCAGCACTATTTCTGGGTTTCATGAACTGCAGCATC
TTACAACCAGTTGTAGGAATGGAAAGAGTTGTCCTCTACAGAGAGAAGGCGGCAGGCATG
TACTCCACTATGGCGTACGCCATTGCTCAGGTGGCAGTTGAATTGCCTTACATGTTTGTC
CAAGTATTCATCTTCTCAGCGATTGTGTACCCAATGATTGGGTTCCAAATGACTGCCACA
AAGTTCTTTTGGTTTGCCCTCTACATGGTGTTAAGTTTCCTGTACTACACGCTCTATGGG
ATGATGACAGTAGCACTAACACCTAACATTGAGATAGCAGCTGGGTTGTCCTTCCTCATC
TTCATCTTTTGGAATGTCTTCTCTGGATTCATCATTGGAAGACAGatgatcccggtgtgg
tggagatgggtgtattgggcaaacccggcggcatggacggtGTACGGGCTCATGTTCTCG
CAGCTGGGAGACCGGACGGAGCTGATCCAGGTGCCAGGGCAGCCAGAGCAGACGGTGAAG
GAGTTCCTGGAGGGCTACCTCGGACTCCAGGACCGCTACTTCAACCTCGTCACCAGCCTG
CACGTCGCCATCATCGCGCTCTTCACCTTCCTCTTCTTCCTCTCCATCAAGCACCTCAAG
TTCCAGAGGCGGTAGCACGGAATTGATGCGTGCAAACTGCAAATATACACTAATAACCAA
TCACTTAACTGTACAAATGTAAGAGAACATAACAAAAATGCACAACATAAGGATTTGTTA
CTAAAATATGTAAACCGTAAGGGATTTGCATGTGTAATAGCAGTATAGAATTGTTGTAGT
ACCATGGTCGAGAAATATACAAAAGAAAGCAAGTGTATATGTTGGAAGAATTTGTAAAGA
TATAGTTTCGTTCGCAGATTGATTGC

CDS

3975 bp

>Os08t0544400-03 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
atggcggcggcggtggagctcactggtgacggaggaaccacggcggagacgaggtggctg
tcgccgccgctcacccacgacgacaaccgcggcTTCCTCCAGATGCTCCGGGAGAAGAAG
GAAAGGTTGGGGGTAGGGGCGGCGAAGGTGGAGGTGAGGCTGGAGAAGCTGACGGTGGAG
GCGGACGTGCGAGTCGGCCGCCGCGCCGTGCCGACGCTGCTCAACTGCGCCATCAACGCC
GCTCAGGAACTAGCAGCCTGTGCGCACATGTGCACCACAAGGAAAAAGCCCATGAAAATT
ATAAATGAAGCAACCGGAACGATTCGACCATCAAGGATGACACTTCTTCTCGGAGCACCT
GGTTCAGGGAAAACAACCTTATTAAAAGCATTAGCAGGAAAGTTGGATTCTTCTCTGAAG
ATGAAAGGAAAGGTCACTTACAATGGAGAAGAAGTGAATTCCTCGACACCTCAGTATCTA
CATGCTTATGTTAGCCAGTATGATCTTCACCATGCTGAAATGACATTATCATCACTTAAA
AAGCTGATTTGCACAGGCCACAACCTTTGGAGAAGGAAGCAACCTTACAACAAACTATAT
TATCAAGCCATAAAAATTGAGTGCATGCAGATACTTGGTTTATCCGAATGCGCTGATACC
CTAGTGGGAGACGAGATGCGAAGAGGCATATCAGGAGGACAAAAGAAAAGAGCTACAATC
GGCGAGATGCTAGTTGGTCTTGCAAGATGCTTCTTCATGGATGATATATCAACTGGTCTA
GATAGCTCCACCACATTTGAGATCATGAAGTTTCTGCAACAAATGGCTCACTTGATGGAT
CTCACAATGGTTATTTCCTTGCTACAACCACCACCTGAGACATTGGAGTTATTTGATGAC
ATAATCCTTTTATGTGAGGGGCAAATTGTGTACCATGGTCCTCGAGAAAATGCTACAGAT
TTCTTTGAAACTATGGGATTCAAATGCCCCAGCAGGAAGAATGTAGCAGATTTCCTTCAA
GAGGTGACCTCGAAGATGGACCAAAAACAATACTGGATAGGCAACGCAAATAAGTATCAA
TACCATTCAATTGAAAAATTTGCAGAGTCCTTCCGTACCTCGTACCTCCCAAGACTCGTA
GAAAATGATCATTTTGAATCAACTAATGCCGGAAAGAGCAAGGAGGTAAAAACAAGCACA
AGTCGCATGATCTCCAGCTGGAATATTTTCAAGGCATGCTTTTCAAGGGAAGTGCTGCTC
CTAAAAAGAAACTCTCCAGTGCATATATTCAAGACCATACAGATAACTGTTCTCGCTTTA
GTGATCTCAACTCTTTTTCTCCGGACAAATATGAGACATGATACTGTACTTGATGCCAAT
AAGTACATGGGAGCACTCTTTATGGCTGTTGTCATAGTAAACTTCAATGGCATGACTGAA
ATTGCAATGACAATAAAGCGGCTCCCCATCTTCTACAAGCAAAGAGAAATACTAGCATTG
CCAGGATGGGCACTCCTTTCTTCAGTATTCCTCCTTAGTCTGCCAATATCATTTGTAGAG
ACAGGTCTTTGGACCGGCTTAACCTACTATGTGATCGGCTACGCACCTTCCTTTGTCAGA
TTTATCCAGCACTTTGTGGTACTTTTTGCCATGCATCAAATGTCAATGAGCCTGTATCGC
TTCTTGGCAGCCATAGGAAGAACACAAGTAATGGCTAATATGCTGGGGACTGCAGCTCTT
ATAGCAATCTACATACTTGGAGGCTTTGTCATATCAAAAGATAACCTCCAACCATGGCTG
CGCTGGGGATATTGGACGTCCCCATTCACCTATGCACAGAATGCAGTTGCCCTGAATGAA
TTCCTTGACGACAGATGGGCTACAGAATTTCATTTCGCAAATGCAAATACTGTTGGTGAA
ACGATCCTCAAGGTAAGGGGGCTGCTCACAGAGTGGCACTGGTACTGGATCTGTGTGAGC
ATTTTGTTTGGATTCTCGCTGGTCTTCAACATCCTCAGCATATTTGCACTACAATACATG
AGATCTCCACACAAGCATCAAGTTAACATCAATGCCACAAAGGTGAAAGTAGACTACAAC
AGCCAGATAGTTGGAAATGGCACGGCATCAACGGACCAAGTCATCCTCCCATTTCAGCCC
CTCTCCCTTGTATTTGATCATATCAATTATTTTGTTGACATGCCTAAGGAGATGACAAAA
TATGGAGTAACAGATAAAAAGCTTCAGCTGCTACAAGATGTCAGTGGTGCTTTCAGGCCA
GGGGTGCTAACAGCTCTGATGGGGATCACTGGTGCTGGAAAGACAACACTGCTCGATGTT
TTGGCTGGAAGAAAAACTGGAGGATACATTGAAGGAACTGTAAAAATAGCAGGCTACCCA
AAGAAGCAGGAGACATTCTCAAGGATCTCAGGCTACTGTGAACAGAGTGACATTCACTCC
CCCAATCTCACCGTATATGAATCACTGCAGTTTTCTGCATGGCTTCGCCTTCCTTCAAAT
GTTAAATCTCACCAGAGaaatATGTTTATAGATGAAGTCATGGACCTAGTTGAGTTAACT
GGACTGAAGAATGCCATGGTTGGCCTAGCAGGAGCGACAGGCCTGTCTGCTGAGCAGCGA
AAAAGACTAACAATAGCTGTTGAGTTGGTAGCTAGTCCTTCCATTATATTTATGGATGAG
CCAACCACTGGTTTGGATGCTCGTGCTGCAGCAATTGTCATGAGAACAGTAAGAAAGACA
GTAGACACTGGACGAACTGTTGTCTGCACAATTCATCAGCCAAGCATCGAGATATTTGAA
TCTTTTGACGAGCTTCTACTTATGAAGAGAGGAGGTCAGCTCATATACAGTGGTTCATTA
GGTCCCCTATCTAGCAATATGATAAAGTATTTCGAGGCTATACCTGGTGTTCCTAGAATA
AAAGAGGGGCAAAACCCAGCAGCGTGGATGTTAGATATCAGTTCGCGCACAGCAGAATAT
GAGATTGGAGTGGACTATGCAGAAATTTATCAGCGCTCATCCCTATACTGGGAGAACAGG
CAACTAATTGATGACCTAGGAAAACCAGAACCAAACACAGAGGATCTACATTTTCCACCC
AAATATTGGCAAGACTTTAGGGCACAATGCATGGCATGCCTGTGGAAGCAAAATTGTGCT
TATTGGAAAAATTCAGAACACAACGTTGTCCGATTCATAAACACATTTGCTGTGTCAATT
ATGTTTGGAATTGTATTCTGGAAAATTGGCTCAACCATtaaggatgagcaagatgtattc
aacatACTAGGGGTTGTGTATGGGTCAGCACTATTTCTGGGTTTCATGAACTGCAGCATC
TTACAACCAGTTGTAGGAATGGAAAGAGTTGTCCTCTACAGAGAGAAGGCGGCAGGCATG
TACTCCACTATGGCGTACGCCATTGCTCAGGTGGCAGTTGAATTGCCTTACATGTTTGTC
CAAGTATTCATCTTCTCAGCGATTGTGTACCCAATGATTGGGTTCCAAATGACTGCCACA
AAGTTCTTTTGGTTTGCCCTCTACATGGTGTTAAGTTTCCTGTACTACACGCTCTATGGG
ATGATGACAGTAGCACTAACACCTAACATTGAGATAGCAGCTGGGTTGTCCTTCCTCATC
TTCATCTTTTGGAATGTCTTCTCTGGATTCATCATTGGAAGACAGatgatcccggtgtgg
tggagatgggtgtattgggcaaacccggcggcatggacggtGTACGGGCTCATGTTCTCG
CAGCTGGGAGACCGGACGGAGCTGATCCAGGTGCCAGGGCAGCCAGAGCAGACGGTGAAG
GAGTTCCTGGAGGGCTACCTCGGACTCCAGGACCGCTACTTCAACCTCGTCACCAGCCTG
CACGTCGCCATCATCGCGCTCTTCACCTTCCTCTTCTTCCTCTCCATCAAGCACCTCAAG
TTCCAGAGGCGGTAG

Protein

1324 aa

>Os08t0544400-03 A member of the pleiotropic drug resistance (PDR) subfamily of ATP-binding cassette (ABC) transporter, Regulation of plant growth and pathogen resistance
MAAAVELTGDGGTTAETRWLSPPLTHDDNRGFLQMLREKKERLGVGAAKVEVRLEKLTVE
ADVRVGRRAVPTLLNCAINAAQELAACAHMCTTRKKPMKIINEATGTIRPSRMTLLLGAP
GSGKTTLLKALAGKLDSSLKMKGKVTYNGEEVNSSTPQYLHAYVSQYDLHHAEMTLSSLK
KLICTGHNLWRRKQPYNKLYYQAIKIECMQILGLSECADTLVGDEMRRGISGGQKKRATI
GEMLVGLARCFFMDDISTGLDSSTTFEIMKFLQQMAHLMDLTMVISLLQPPPETLELFDD
IILLCEGQIVYHGPRENATDFFETMGFKCPSRKNVADFLQEVTSKMDQKQYWIGNANKYQ
YHSIEKFAESFRTSYLPRLVENDHFESTNAGKSKEVKTSTSRMISSWNIFKACFSREVLL
LKRNSPVHIFKTIQITVLALVISTLFLRTNMRHDTVLDANKYMGALFMAVVIVNFNGMTE
IAMTIKRLPIFYKQREILALPGWALLSSVFLLSLPISFVETGLWTGLTYYVIGYAPSFVR
FIQHFVVLFAMHQMSMSLYRFLAAIGRTQVMANMLGTAALIAIYILGGFVISKDNLQPWL
RWGYWTSPFTYAQNAVALNEFLDDRWATEFHFANANTVGETILKVRGLLTEWHWYWICVS
ILFGFSLVFNILSIFALQYMRSPHKHQVNINATKVKVDYNSQIVGNGTASTDQVILPFQP
LSLVFDHINYFVDMPKEMTKYGVTDKKLQLLQDVSGAFRPGVLTALMGITGAGKTTLLDV
LAGRKTGGYIEGTVKIAGYPKKQETFSRISGYCEQSDIHSPNLTVYESLQFSAWLRLPSN
VKSHQRNMFIDEVMDLVELTGLKNAMVGLAGATGLSAEQRKRLTIAVELVASPSIIFMDE
PTTGLDARAAAIVMRTVRKTVDTGRTVVCTIHQPSIEIFESFDELLLMKRGGQLIYSGSL
GPLSSNMIKYFEAIPGVPRIKEGQNPAAWMLDISSRTAEYEIGVDYAEIYQRSSLYWENR
QLIDDLGKPEPNTEDLHFPPKYWQDFRAQCMACLWKQNCAYWKNSEHNVVRFINTFAVSI
MFGIVFWKIGSTIKDEQDVFNILGVVYGSALFLGFMNCSILQPVVGMERVVLYREKAAGM
YSTMAYAIAQVAVELPYMFVQVFIFSAIVYPMIGFQMTATKFFWFALYMVLSFLYYTLYG
MMTVALTPNIEIAAGLSFLIFIFWNVFSGFIIGRQMIPVWWRWVYWANPAAWTVYGLMFS
QLGDRTELIQVPGQPEQTVKEFLEGYLGLQDRYFNLVTSLHVAIIALFTFLFFLSIKHLK
FQRR*

CDS

chr08:27268083..27268207 (+ strand) : 125 bp

chr08:27268368..27268488 (+ strand) : 121 bp

chr08:27270697..27270785 (+ strand) : 89 bp

chr08:27271018..27271102 (+ strand) : 85 bp

chr08:27271212..27271316 (+ strand) : 105 bp

chr08:27271688..27271769 (+ strand) : 82 bp

chr08:27271815..27271928 (+ strand) : 114 bp

chr08:27272271..27272572 (+ strand) : 302 bp

chr08:27272761..27273356 (+ strand) : 596 bp

chr08:27273458..27273618 (+ strand) : 161 bp

chr08:27273731..27273834 (+ strand) : 104 bp

chr08:27273939..27274098 (+ strand) : 160 bp

chr08:27274184..27274347 (+ strand) : 164 bp

chr08:27274455..27274787 (+ strand) : 333 bp

chr08:27274882..27275172 (+ strand) : 291 bp

chr08:27275518..27275601 (+ strand) : 84 bp

chr08:27275672..27275805 (+ strand) : 134 bp

chr08:27275907..27276134 (+ strand) : 228 bp

chr08:27276235..27276406 (+ strand) : 172 bp

chr08:27276505..27276759 (+ strand) : 255 bp

chr08:27277020..27277289 (+ strand) : 270 bp

3'UTR

chr08:27277290..27277540 (+ strand) : 251 bp

FASTA

>Os08t0544400-03 class=Sequence position=chr08:27268083..27277540 (+ strand)
atggcggcgg cggtggagct cactggtgac ggaggaacca cggcggagac gaggtggctg tcgccgccgc tcacccacga
cgacaaccgc ggcTTCCTCC AGATGCTCCG GGAGAAGAAG GAAAGGTAAA TAGATGTATG CATGCAACTA TATATGCAAG
AATTGAATCA AGATGATCGA TCTTTTGCTT TCTTAGAAAA AAGAACTTGT ATATGCAAGA TCGATGGTTA ATTCATCAGA
TTGATGTATG GATTATTGGC AATATATGTG TGTGTGGATT TGCAGGTTGG GGGTAGGGGC GGCGAAGGTG GAGGTGAGGC
TGGAGAAGCT GACGGTGGAG GCGGACGTGC GAGTCGGCCG CCGCGCCGTG CCGACGCTGC TCAACTGCGC CATCAACGCC
GCTCAGGTAA TTAGCAGCAA ATTCTTCCAG CCACTGTTGA TTTGTTACCT TTCTTCTCCC TTAAACATAT CATCAACATA
TATTGTCTGC TGCATATGCA TGCCTTCTCG GCCTTTCGGT TTCTTTGTCC AAGCCTGAAA GCGCTTTCGC TTTCGTCCTT
TTCTTTCTCT TGCATGCACA CGGATGACAT GGCATGCATC GCAAATGTCG AAAATGTCGA GAGAGATGAT AAAGAGTGAG
ATATGTGGTC TGCCACATAT AGAGAAGAGG TTGTGATCCG TAGATCAGTT CAACTCCGAT CAAGTGCTTG GGCATTAATT
AGTGTGTGTG TGTGTGCCTG CCTCCTAATT TTGGGTTGTT TGTTCATCCG GAAAACCAGC TATTGGTTAG TCCATGGACT
CCTACTGGAA ACCTAGCTAG TAGTAGCACA AACATGCATG CAGATGGAAT GGTAGTAGAA TGAATCCATA GCTTGCATGT
GTTTAGTTAC ACATACTTTG TGTTGGTAAT CGATTGAGAT AGTGACTTAC TATAACTAGA ACAAGGACAG TTGGGTGGCT
ATCCAACAAT AATATTTCGA GAATAACTAT GCCATAAATC GGCATAAACC TGTCCTACAC ACAACTGTTC TCTACTGTTT
ACTGAAAGCT AGTATAGTAG TTAGTTTGTC ATGTAATCCA GTGTGGATCT CGTAATTTTC GAGTGCATTT TTCCAAGTAT
AAGAAGACAA AAACTTAATT ATCAAAAATA TATCTGTTTC CATCTTATAA GGCACTTTGT AATACACTAA TACTAGGCTG
GATTAAATTA GGTGTTGGCC CATGATTTAG GTTAGTCTTA TTCTACTATC TATCACAAAA TTAAGATAGA GTAAGGTGGG
ATATATTATG GCGTATATAA TAATTAAATA ATAGGCCAAT ATATTCGTAT AAATAGGGCT GCCCCCACCA TGTCTACCTC
AAACAGAGAG CAATGACATG GGCTTCTTTC ACCCAACCGG CAACAGATCA TTCATAAATC CTGATGATAT TCCCAATAAC
TAAGCCAGGT CAAATAATGC ACGGTAATAA ATTCAGAGGT ATAGCAGTAT ATAGCACAGA TATCTAACCT GTCTTTTACT
CGAGCTAGAG CTCCAGCAGC CTGAACAGTG CATCGATGAC GACATCGGTA GTGAAGATGA TGGCATCTGC ATTAATCGTG
GGCTTGTCGT TTGGCCCCGG GCTGTTGCTT GTTCCTTTCC CTGATGAGAG AAAACAGATC AGAGAACTGG GCACGCACGC
CTCTTTTGGA TCATCCATAA ACTAAATTCC AAGGTTTCAG ATTCCGGTGG TGCTGTTCAC CAGCTGCAGC TATTTATTAG
CTACAGCAGA TACTCCATCT AAGAAAAGAG ATCATAAGAC ACTATACTTA CCTGATAATC TGATAGCCGG AATTATTCCA
GATTTTCTTC CTGTTTGCAA TCGTGCCAAG TTTCTGGTGC AGCTATTGGG AATGATTGGC GAATAGCCAA AATGCAGATA
TCTGACCAGA TATCCTAGAT CCTTGGAGGC ATGTTTAATC ATATATGTCG AGATTCTGAC AAGTATGTCA AGCTTGACTA
GATCAGTTTA ATGGCCCAGC ACTGTTTTGA CCGCAGGCCT GCAGCTGTTT GTCCCTTTTC TCTCCATGCA TGCATTTCAG
AATTCAGAAA TCCTTATGAT CAGTTGATTT CTCCGGAGAG AAGTGATCCT TTGGCAGTTT GGCAGGTCAA TTTTCTTTCG
TTTTCAGAAA GTACAGCACG TGCCAACGTG TCCAGTATAT CCCACGAAAG CTCGCAACAC GTGTGTGCAT AGAGCCTGAA
CACCGCGCGC CTAACATAGC CAAAATGATC CCAGATTACC TGCACATTAG GTCAGGAGTT TGAAAAACTG TATTACAAAA
CGACAAACAG ATGAATTACG TGCAAGCCAC AATACAAGAC AACGAAAAAA TATCGAATAT ATACCATGAG TCCATAGGTA
CAAGTGCAGA ACTACTTCTG GATTAGAATG TGTGGAAAAA TAAAAGCGAG TTGACACAGC ATGTCTGTAT CTTAACACAG
TATAAATTGA ACGCACGCGT ACGTAATCTC TTTCCAGGAC AAGATGGCAG CGTCATTTGC TTTGCAACTA TGTTGTGAGT
CGATTTAAAA GTCAAAACCA TCTTTCTGAA ATAACATTTC AATTTGATAT GCAGGAACTA GCAGCCTGTG CGCACATGTG
CACCACAAGG AAAAAGCCCA TGAAAATTAT AAATGAAGCA ACCGGAACGA TTCGACCATC AAGGTAAGCA TCGAGTACTA
TTTACGACCG CAAGAGGTTA AGACAAATAC CAATTAAACT GAAAATAACT GCTATCATTT TCTAAGAAAT TTGACTAACT
TCTTAAAAGT ACAGAAACAG AAAGTTCATT ATTCACAAAT TTCAAATAAA AAATGAATTA TGATCTATCA CTTTAATTAT
TGCACTAATT ATCTTACCTG AGGTAATGAA ATTTTGCAAC CCATTCTGCA ATCAGGATGA CACTTCTTCT CGGAGCACCT
GGTTCAGGGA AAACAACCTT ATTAAAAGCA TTAGCAGGAA AGTTGGATTC TTCTCTGAAG GTAAAGTGAA TGTGAATTGT
GTACATTCCA TTAAAAGTAT GTACTTAACA TAATGCGTAG CATTGACTAA ACAATGCATT TTCTTTCATG ATGTAACATT
TCTCAATAGA TGAAAGGAAA GGTCACTTAC AATGGAGAAG AAGTGAATTC CTCGACACCT CAGTATCTAC ATGCTTATGT
TAGCCAGTAT GATCTTCACC ATGCTGAAAT GACAGTGAGA GAAACTATTG ACTTCTCATC CAAGATGTTG GGAACTAATA
ATGAATTTGG TAAGACAACA TCTTCTGTAT GGCGTGTTAT TCAATTCACA AACAAGATAT GACTTTTGTG TACCCTATTC
TATTTCACAA TTTAAAAGAC ATTGGGTGCT GTAACTCATG AAATTTTCAT GGACGTACTT AAGGTATGTT AATTTTTGTA
TGGCATAAAG ACTAACTCAT TCCTGTTTGA AATGACCACC TTAGAGATGC TGGGAGAAGC AATTAGAAGA AAAAAAGGTG
TCATCAATAG AGTGGACCAA GAACTTGACT CTTTTATTAA GGTGGTTAAC CTTTTTTTTT TGCATAAAAC TCATTTCTTA
TTTAGTTATC ATCACTTAAA AAGCTGATTT GCACAGGCCA CAACCTTTGG AGAAGGAAGC AACCTTACAA CAAACTATAT
TATCAAGGTT AGTGTGTTGT TTGTTTGATT CATTATTTAT CCTGAGGCAC AGCCATAAAA ATTGAGTGCA TGCAGATACT
TGGTTTATCC GAATGCGCTG ATACCCTAGT GGGAGACGAG ATGCGAAGAG GCATATCAGG AGGACAAAAG AAAAGAGCTA
CAATCGGTAA GCATTTTGTC TTTTTCTACT ATGTATTTTG TTTCTCTCGT CATCCTCTAT TATCACTTCT CCAGTAAATA
TTTGTATCTT TTTCTACTAC GTTTTCTGCT CGTATCATCA TCCTCTATTA CCACTTAAGA GTACATTCAA TTAGTCCGGT
ATAGGAAAGA AAACTTTTAT CATCTCAACA ACTTAATTAT TGTATGAAAG AAAGAAAAGT AAAGTCCTTA TCATCGTAGA
AATCTGCATG GTAAAATGCT TCTAGCCATC GAGCCAGATG GCAGCAAGTA AGCAGAGAAA GAGCAGGACC AGATAAACGA
CATACTTACA GGTGCTTCGT TGATGCAGGC GAGATGCTAG TTGGTCTTGC AAGATGCTTC TTCATGGATG ATATATCAAC
TGGTCTAGAT AGCTCCACCA CATTTGAGAT CATGAAGTTT CTGCAACAAA TGGCTCACTT GATGGATCTC ACAATGGTTA
TTTCCTTGCT ACAACCACCA CCTGAGACAT TGGAGTTATT TGATGACATA ATCCTTTTAT GTGAGGGGCA AATTGTGTAC
CATGGTCCTC GAGAAAATGC TACAGATTTC TTTGAAACTA TGGGATTCAA ATGCCCCAGC AGGAAGAATG TAGCAGATTT
CCTTCAAGAG GTACTCCATT ATCAATTACT CCTATCATAA AGAAAAATTG TCAAATAAAA ACATTGCTAA CAGTTGATCT
CCTTACAGAG CAACTTCAGG ATAGCCACGT TTTTCTTGTG TTCCCAAAAT CAATTATTCT CTAATAGGTA CTTGTGCATA
ACAACATAAT ACTAACAGTA ACTTTCTCAT TTGGTCAGGT GACCTCGAAG ATGGACCAAA AACAATACTG GATAGGCAAC
GCAAATAAGT ATCAATACCA TTCAATTGAA AAATTTGCAG AGTCCTTCCG TACCTCGTAC CTCCCAAGAC TCGTAGAAAA
TGATCATTTT GAATCAACTA ATGCCGGAAA GAGCAAGGAG GTAAAAACAA GCACAAGTCG CATGATCTCC AGCTGGAATA
TTTTCAAGGC ATGCTTTTCA AGGGAAGTGC TGCTCCTAAA AAGAAACTCT CCAGTGCATA TATTCAAGAC CATACAGATA
ACTGTTCTCG CTTTAGTGAT CTCAACTCTT TTTCTCCGGA CAAATATGAG ACATGATACT GTACTTGATG CCAATAAGTA
CATGGGAGCA CTCTTTATGG CTGTTGTCAT AGTAAACTTC AATGGCATGA CTGAAATTGC AATGACAATA AAGCGGCTCC
CCATCTTCTA CAAGCAAAGA GAAATACTAG CATTGCCAGG ATGGGCACTC CTTTCTTCAG TATTCCTCCT TAGTCTGCCA
ATATCATTTG TAGAGACAGG TCTTTGGACC GGCTTAACCT ACTATGTGAT CGGCTACGCA CCTTCCTTTG TCAGGTACTC
CTCCTAGCAA GTTCTATATT TAAACAATAA GGATAAGGAT TTTCTTACTT GAATAGATTG AAGTAACAGG TGGAAGTTTC
TCTTGCTTCT GACAGATTTA TCCAGCACTT TGTGGTACTT TTTGCCATGC ATCAAATGTC AATGAGCCTG TATCGCTTCT
TGGCAGCCAT AGGAAGAACA CAAGTAATGG CTAATATGCT GGGGACTGCA GCTCTTATAG CAATCTACAT ACTTGGAGGC
TTTGTCATAT CAAAAGGTTA GACGATTTTG CTTAGAGTAC CTTGAAAAGT ATGGCAACTC TGTACTACAG GAAACAATTT
AAGGCTTATG TGCAGTAATG ATACTCACCA GTTTGTACAC TTGTCCAGAT AACCTCCAAC CATGGCTGCG CTGGGGATAT
TGGACGTCCC CATTCACCTA TGCACAGAAT GCAGTTGCCC TGAATGAATT CCTTGACGAC AGATGGGCTA CAGTAAGAAC
TCATTTCAAC ACTTGAGATA GCTAACCAAA AAGTAGAGTA AAATTCTTGA TCAAAGCTGT TTAAAAATTC CTAATGATGA
TGATCTCTGC TTATAGGAAT TTCATTTCGC AAATGCAAAT ACTGTTGGTG AAACGATCCT CAAGGTAAGG GGGCTGCTCA
CAGAGTGGCA CTGGTACTGG ATCTGTGTGA GCATTTTGTT TGGATTCTCG CTGGTCTTCA ACATCCTCAG CATATTTGCA
CTACAATACA TGAGATGTAT GTACGCCAAG CTACACTAAG CCTCATAGAT ACTGAAATAG AAATACAAAT GGTACTCACT
CTTGTTGGTT ATCATATGCA GCTCCACACA AGCATCAAGT TAACATCAAT GCCACAAAGG TGAAAGTAGA CTACAACAGC
CAGATAGTTG GAAATGGCAC GGCATCAACG GACCAAGTCA TCCTCCCATT TCAGCCCCTC TCCCTTGTAT TTGATCATAT
CAATTATTTT GTTGACATGC CTAAGGTAAG ATCTTGACCA CATCAGACAT TACCAAATAG TTTAATCATG TTAACCACAT
CCAATCTGTT GCTCCACTCT TGATCTTAAT CAACTGTGAA TATCTTTGAC AGGAGATGAC AAAATATGGA GTAACAGATA
AAAAGCTTCA GCTGCTACAA GATGTCAGTG GTGCTTTCAG GCCAGGGGTG CTAACAGCTC TGATGGGGAT CACTGGTGCT
GGAAAGACAA CACTGCTCGA TGTTTTGGCT GGAAGAAAAA CTGGAGGATA CATTGAAGGA ACTGTAAAAA TAGCAGGCTA
CCCAAAGAAG CAGGAGACAT TCTCAAGGAT CTCAGGCTAC TGTGAACAGA GTGACATTCA CTCCCCCAAT CTCACCGTAT
ATGAATCACT GCAGTTTTCT GCATGGCTTC GCCTTCCTTC AAATGTTAAA TCTCACCAGA Gaaatgtatg tgcattgacc
tcttgtcctt tttctcacat agttggaagc tcacatcaaa cataggatct catgatattt atgttcaAAC ATATTTCAGA
TGTTTATAGA TGAAGTCATG GACCTAGTTG AGTTAACTGG ACTGAAGAAT GCCATGGTTG GCCTAGCAGG AGCGACAGGC
CTGTCTGCTG AGCAGCGAAA AAGACTAACA ATAGCTGTTG AGTTGGTAGC TAGTCCTTCC ATTATATTTA TGGATGAGCC
AACCACTGGT TTGGATGCTC GTGCTGCAGC AATTGTCATG AGAACAGTAA GAAAGACAGT AGACACTGGA CGAACTGTTG
TCTGCACAAT TCATCAGCCA AGCATCGAGA TATTTGAATC TTTTGACGAG GTATGAGTAA GTCAATAAAT GAGTCAAAAA
TATTTTCCAC TACAAAATCA AGAAAGAATA GTCCAGTAGT GGCAGGTGAA TGACTGAACG ATAATTGAAA GCACAGCACC
AAAAGTAGTG CTTTTTGTCA AATCAAACAG CAAAACTAAT TGACTTCACA TTTATGCTCC CCTTTCTTCA ATAGTAGCAC
ACATTAAAAT GTTCTTTTAA CACAAGCAAC cattaaagtg ttaaagatag ttgtgacaag tagaatattt caggaaccac
agctcaattt acctttccta tgaacaagta cataggtcgt ccttctGAAT TTGAGTTCAA TCTTATTGAT CGCAGCTTCT
ACTTATGAAG AGAGGAGGTC AGCTCATATA CAGTGGTTCA TTAGGTCCCC TATCTAGCAA TATGATAAAG TATTTCGAGG
TAAGATTACC TAAGATTGGG TTCTTGTTCC AAAATGGAGA GAAGAGGTCT TAAAATTCTT TTGTCGCAGG CTATACCTGG
TGTTCCTAGA ATAAAAGAGG GGCAAAACCC AGCAGCGTGG ATGTTAGATA TCAGTTCGCG CACAGCAGAA TATGAGATTG
GAGTGGACTA TGCAGAAATT TATCAGCGCT CATCCCTATA CTGGTAACGC AATACGATCA TAAAGCAAAA ATTACTATTT
TGCTAACTTG TTTGAACAAG AAGGAAAAGG ATAAACATGA TGAAATCACA CATGGTTTCT TCAGGGAGAA CAGGCAACTA
ATTGATGACC TAGGAAAACC AGAACCAAAC ACAGAGGATC TACATTTTCC ACCCAAATAT TGGCAAGACT TTAGGGCACA
ATGCATGGCA TGCCTGTGGA AGCAAAATTG TGCTTATTGG AAAAATTCAG AACACAACGT TGTCCGATTC ATAAACACAT
TTGCTGTGTC AATTATGTTT GGAATTGTAT TCTGGAAAAT TGGCTCAACC ATGTAAGTAC GAATAGCTAT CCAAATATTT
TTATTTCATG AGAACTTGTA GTGCTTCAAT ATTGTTTTGG TTAAATGCTA ACTTTGttct cctgtgcaac agtaaggatg
agcaagatgt attcaacatA CTAGGGGTTG TGTATGGGTC AGCACTATTT CTGGGTTTCA TGAACTGCAG CATCTTACAA
CCAGTTGTAG GAATGGAAAG AGTTGTCCTC TACAGAGAGA AGGCGGCAGG CATGTACTCC ACTATGGCGT ACGCCATTGC
TCAGGTAATT AATATATAGA TCTGTATAAA AAAAACAACT ATTCTGAAAA ATAGAGGATT TGAAATGGAC TCTAAACACA
AATGCTGGAT TCTTGTGTGC AGGTGGCAGT TGAATTGCCT TACATGTTTG TCCAAGTATT CATCTTCTCA GCGATTGTGT
ACCCAATGAT TGGGTTCCAA ATGACTGCCA CAAAGTTCTT TTGGTTTGCC CTCTACATGG TGTTAAGTTT CCTGTACTAC
ACGCTCTATG GGATGATGAC AGTAGCACTA ACACCTAACA TTGAGATAGC AGCTGGGTTG TCCTTCCTCA TCTTCATCTT
TTGGAATGTC TTCTCTGGAT TCATCATTGG AAGACAGGTA CTACTACCCT GCTACTCTGT TGTTTCAAGT CCCCAATTTT
TGTCAAAACC TTAAATTTAG GTTCTACTAG GGAGGATAAA TCTAAAATTC TCAGACCTCT TCCTAACAAA ATTGATAAAA
AGTTTACCCT TGATAACCCC ACAACTTCAT AATCAGAGAT CGTGTCTTAG ATTTCGTTTT GAACATTTGT GTGTGCTTGC
GAAGAAAAGA AAATTTGTAT GTTTGACTAA CCTGATGAAC AACAACAAAt gatgcagatg atcccggtgt ggtggagatg
ggtgtattgg gcaaacccgg cggcatggac ggtGTACGGG CTCATGTTCT CGCAGCTGGG AGACCGGACG GAGCTGATCC
AGGTGCCAGG GCAGCCAGAG CAGACGGTGA AGGAGTTCCT GGAGGGCTAC CTCGGACTCC AGGACCGCTA CTTCAACCTC
GTCACCAGCC TGCACGTCGC CATCATCGCG CTCTTCACCT TCCTCTTCTT CCTCTCCATC AAGCACCTCA AGTTCCAGAG
GCGGTAGCAC GGAATTGATG CGTGCAAACT GCAAATATAC ACTAATAACC AATCACTTAA CTGTACAAAT GTAAGAGAAC
ATAACAAAAA TGCACAACAT AAGGATTTGT TACTAAAATA TGTAAACCGT AAGGGATTTG CATGTGTAAT AGCAGTATAG
AATTGTTGTA GTACCATGGT CGAGAAATAT ACAAAAGAAA GCAAGTGTAT ATGTTGGAAG AATTTGTAAA GATATAGTTT
CGTTCGCAGA TTGATTGC

Locus: Os08g0544400

Loading...

Locus: Os08g0544400

Loading...