Os08t0546100-00

Locus

Os08g0546100

Description

Similar to protein binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG2

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 2

Oryzabase Gene Symbol Synonym(s)

OsBAG2

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 2

Transcript Evidence

FP095381 (DDBJ)

Protein Evidence

B6TJD1 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

BAG domain (IPR003103)

Ubiquitin supergroup (IPR019955)

Expression Databases

TENOR (Os08t0546100-00)

Others

Oryzabase (11551)

Transcript

1462 bp

>Os08t0546100-00 Similar to protein binding protein.
GTTGTACCCTGTCTTTTTCTTCCTCCTCATACCCTTTCTTCTTAGCTCTTCCTCCCATTC
CTTCTTCGATTCATTCCTGTCTCCAATTGGAGGTCACAATTGCAGCTTGCAGCTAGCTCA
AATTTCCATTTTTTGTTTGGTTGTCTCTCGGCAGCAAAGCAGATATAGAGCAGAGGAAAG
CTAAGCTAAATTAGTTAGTTAGATTACTAGTCTCTGGCAGCTGGTATATTATAGGATTAA
CTACTACTAGGATAGTACTCCTATATGAGAAGAAGATGATGCGCGGGAAGGATCAGAAAT
TTCCGGCGATGAAGAAGGAGACGGCGGCGGTGGCGAAGGAGGAGGTGTGGGAGGTGCGGC
CCGGCGGCATGCTGGTGCAGAAGCGGAGCCCGGAGTCGGAGCCACCGCCGGGCGGCGCGC
CGGTGCCGACGATCCGGGTGAAGGTGAAGTACAACGGGGTGTACCACGAGATCTACATCA
ACTCGCAGGCGTCCTTCGGCGAGCTGAAGAAGCTCCTGTCGGAGAAGACGGGGCTCCACC
CCGACGACCAGAAGGTGGTGTACAGGGACAAGGAGAGGGACTCCAAGGCGTTCCTCGACA
TCGCCGGCGTCAAGGACCGCTCCAAGATGCTCCTCCTCGAGGACCCCACCGCCCAGGCCA
AGCGCCTCCTCGAGGAGCGCCGCCATTGCAAGGCTGAGCGCGCCGCCAAGTCCGTCTCCC
GCGTCGCCCTCGACGTCGACAAGCTCGCCTCCAAGGTGTCGGCGCTGGAGGCGATCGTGA
GCAAGGGCGGGAGGGTGGTTGACGCCGACGTGGTGGCGCTCACCGAGGCGCTGATGAATG
AGCTGGTCAAGCTCGACTCCATCGCCGCCGACGGCGAGGTCAAGGAGCAGCGCCGAGTGC
AGGAGAAGCGGGTGCAGAAGTACGTCGAGGCCCTCGACGCCATCCGTGCCAAGACCAAGA
AAGCGGCGGCGGCGCCGCCCAAGGCCCGGCCGCCGCACCTGCCGCCGCGGCCGCCGCCGG
CGCAGCAGCAGCAGCGCCGGCAGTTCCAGCCGCCGGCGCCCGCCACGGCGACCGCGCCGG
CGCCACAGACCGCGACGGCCAGCTGGGAGTCGTTCGACCTGCTCTCAtccgtgccgtcca
cgtcgtcggccccggtgaccaccatggcgccggcgaccaccaccaccacctcgccgTCGC
CGAGGTTCGAGTGGGAGCTCTTCTAGACGATGTGGGGCCCACACTGGCCGCATGTGTGTA
CACGTTCATTGGCCGGTCGGTACCTATGCCTTTCTTGCATGTTCATCTTTGGTCACTCAT
GGTGCATGTCAATTGTCATTCTTCCTTTCCTCTCTCTCCCCAATTCTTTCTTTCTTTCTT
TCTTTCTTTTCTGAATTCTGAGTGTATATTGATCTCTACAAAAAAAGGGGCTAAAATGTC
AAGTGAGTGAGTGAGTGTGATC

CDS

951 bp

>Os08t0546100-00 Similar to protein binding protein.
ATGATGCGCGGGAAGGATCAGAAATTTCCGGCGATGAAGAAGGAGACGGCGGCGGTGGCG
AAGGAGGAGGTGTGGGAGGTGCGGCCCGGCGGCATGCTGGTGCAGAAGCGGAGCCCGGAG
TCGGAGCCACCGCCGGGCGGCGCGCCGGTGCCGACGATCCGGGTGAAGGTGAAGTACAAC
GGGGTGTACCACGAGATCTACATCAACTCGCAGGCGTCCTTCGGCGAGCTGAAGAAGCTC
CTGTCGGAGAAGACGGGGCTCCACCCCGACGACCAGAAGGTGGTGTACAGGGACAAGGAG
AGGGACTCCAAGGCGTTCCTCGACATCGCCGGCGTCAAGGACCGCTCCAAGATGCTCCTC
CTCGAGGACCCCACCGCCCAGGCCAAGCGCCTCCTCGAGGAGCGCCGCCATTGCAAGGCT
GAGCGCGCCGCCAAGTCCGTCTCCCGCGTCGCCCTCGACGTCGACAAGCTCGCCTCCAAG
GTGTCGGCGCTGGAGGCGATCGTGAGCAAGGGCGGGAGGGTGGTTGACGCCGACGTGGTG
GCGCTCACCGAGGCGCTGATGAATGAGCTGGTCAAGCTCGACTCCATCGCCGCCGACGGC
GAGGTCAAGGAGCAGCGCCGAGTGCAGGAGAAGCGGGTGCAGAAGTACGTCGAGGCCCTC
GACGCCATCCGTGCCAAGACCAAGAAAGCGGCGGCGGCGCCGCCCAAGGCCCGGCCGCCG
CACCTGCCGCCGCGGCCGCCGCCGGCGCAGCAGCAGCAGCGCCGGCAGTTCCAGCCGCCG
GCGCCCGCCACGGCGACCGCGCCGGCGCCACAGACCGCGACGGCCAGCTGGGAGTCGTTC
GACCTGCTCTCAtccgtgccgtccacgtcgtcggccccggtgaccaccatggcgccggcg
accaccaccaccacctcgccgTCGCCGAGGTTCGAGTGGGAGCTCTTCTAG

Protein

317 aa

>Os08t0546100-00 Similar to protein binding protein.
MMRGKDQKFPAMKKETAAVAKEEVWEVRPGGMLVQKRSPESEPPPGGAPVPTIRVKVKYN
GVYHEIYINSQASFGELKKLLSEKTGLHPDDQKVVYRDKERDSKAFLDIAGVKDRSKMLL
LEDPTAQAKRLLEERRHCKAERAAKSVSRVALDVDKLASKVSALEAIVSKGGRVVDADVV
ALTEALMNELVKLDSIAADGEVKEQRRVQEKRVQKYVEALDAIRAKTKKAAAAPPKARPP
HLPPRPPPAQQQQRRQFQPPAPATATAPAPQTATASWESFDLLSSVPSTSSAPVTTMAPA
TTTTTSPSPRFEWELF*

5'UTR

chr08:27358551..27358774 (- strand) : 224 bp

chr08:27358443..27358493 (- strand) : 51 bp

CDS

chr08:27357963..27358442 (- strand) : 480 bp

chr08:27357415..27357885 (- strand) : 471 bp

3'UTR

chr08:27357179..27357414 (- strand) : 236 bp

FASTA

>Os08t0546100-00 class=Sequence position=chr08:27357179..27358774 (- strand)
GTTGTACCCT GTCTTTTTCT TCCTCCTCAT ACCCTTTCTT CTTAGCTCTT CCTCCCATTC CTTCTTCGAT TCATTCCTGT
CTCCAATTGG AGGTCACAAT TGCAGCTTGC AGCTAGCTCA AATTTCCATT TTTTGTTTGG TTGTCTCTCG GCAGCAAAGC
AGATATAGAG CAGAGGAAAG CTAAGCTAAA TTAGTTAGTT AGATTACTAG TCTCTGGCAG CTGGGTGATC TTAATTTGAT
CAAAGAAGAA GAAGAAGAAG CAAGTTTTTT TAGCTCCTGA GTATATTATA GGATTAACTA CTACTAGGAT AGTACTCCTA
TATGAGAAGA AGATGATGCG CGGGAAGGAT CAGAAATTTC CGGCGATGAA GAAGGAGACG GCGGCGGTGG CGAAGGAGGA
GGTGTGGGAG GTGCGGCCCG GCGGCATGCT GGTGCAGAAG CGGAGCCCGG AGTCGGAGCC ACCGCCGGGC GGCGCGCCGG
TGCCGACGAT CCGGGTGAAG GTGAAGTACA ACGGGGTGTA CCACGAGATC TACATCAACT CGCAGGCGTC CTTCGGCGAG
CTGAAGAAGC TCCTGTCGGA GAAGACGGGG CTCCACCCCG ACGACCAGAA GGTGGTGTAC AGGGACAAGG AGAGGGACTC
CAAGGCGTTC CTCGACATCG CCGGCGTCAA GGACCGCTCC AAGATGCTCC TCCTCGAGGA CCCCACCGCC CAGGCCAAGC
GCCTCCTCGA GGAGCGCCGC CATTGCAAGG CTGAGCGCGC CGCCAAGTCC GTCTCCCGCG TCGCCCTCGA CGTCGACAAG
CTCGCCTCCA AGGTAGCTAC CCCGCTGCTT TGCTTTGCTT GTCTTCTCCG ACTCCGGCGT CGTTGAGCTG TTTGGTGGTG
TACGTGCAGG TGTCGGCGCT GGAGGCGATC GTGAGCAAGG GCGGGAGGGT GGTTGACGCC GACGTGGTGG CGCTCACCGA
GGCGCTGATG AATGAGCTGG TCAAGCTCGA CTCCATCGCC GCCGACGGCG AGGTCAAGGA GCAGCGCCGA GTGCAGGAGA
AGCGGGTGCA GAAGTACGTC GAGGCCCTCG ACGCCATCCG TGCCAAGACC AAGAAAGCGG CGGCGGCGCC GCCCAAGGCC
CGGCCGCCGC ACCTGCCGCC GCGGCCGCCG CCGGCGCAGC AGCAGCAGCG CCGGCAGTTC CAGCCGCCGG CGCCCGCCAC
GGCGACCGCG CCGGCGCCAC AGACCGCGAC GGCCAGCTGG GAGTCGTTCG ACCTGCTCTC Atccgtgccg tccacgtcgt
cggccccggt gaccaccatg gcgccggcga ccaccaccac cacctcgccg TCGCCGAGGT TCGAGTGGGA GCTCTTCTAG
ACGATGTGGG GCCCACACTG GCCGCATGTG TGTACACGTT CATTGGCCGG TCGGTACCTA TGCCTTTCTT GCATGTTCAT
CTTTGGTCAC TCATGGTGCA TGTCAATTGT CATTCTTCCT TTCCTCTCTC TCCCCAATTC TTTCTTTCTT TCTTTCTTTC
TTTTCTGAAT TCTGAGTGTA TATTGATCTC TACAAAAAAA GGGGCTAAAA TGTCAAGTGA GTGAGTGAGT GTGATC

Locus: Os08g0546100

Loading...

Locus: Os08g0546100

Loading...