Os08t0549100-01

Locus

Os08g0549100

Description

Similar to Peroxisome type ascorbate peroxidase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

APX4

CGSNL Gene Name

ASCORBATE PEROXIDASE 4

Oryzabase Gene Symbol Synonym(s)

OsAPx4, OsAPx04, OSAPX4, APx4, pAPX4

Oryzabase Gene Name Synonym(s)

ascorbate peroxidase 4, Peroxisomal APX 4

Transcript Evidence

AK070842 (DDBJ, Best hit)

AK104490 (DDBJ, Best hit)

Protein Evidence

Q94IC3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to oxidative stress (GO:0006979)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: peroxidase activity (GO:0004601)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Haem peroxidase, plant/fungal/bacterial (IPR002016)

Plant ascorbate peroxidase (IPR002207)

Haem peroxidase (IPR010255)

Peroxidases heam-ligand binding site (IPR019793)

Peroxidase, active site (IPR019794)

Full-length cDNA

J023074O14 (Online Clone Ordering)

006-302-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0549100-01)

RiceXPro (AK070842)

Others

Oryzabase (8954)

KEGG (Os08t0549100-01 (EC:1.11.1.11))

Transcript

1228 bp

>Os08t0549100-01 Similar to Peroxisome type ascorbate peroxidase.
AGTGAGTACTAGTCACACCACACGCTTGGCTTGACGCCGCACGCCTCCGCTCCGCTCCGC
CGCCGCGGCCGATCTCTCTAGGGCTTCCAACCTCGCCGGCGACGCGACGCCACGCCATGG
CCGCCCCGGTCGTGGACGCCGAGTACCTCCGCCAGGTCGACAGGGCGCGCCGCCACCTCC
GCGCCCTCATCTCCTCCAAGGGATGCGCGCCCATCATGCTCCGCCTCGCATGGCATGACG
CGGGCACTTATGACGTGAACACAAAAACTGGTGGTGCAAATGGTTCAATTAGATACGAGG
AAGAGTACACTCACGGTTCAAATGCTGGTCTAAAGATTGCTATTGATCTTCTCGAGCCTA
TTAAAGCCAAGAGCCCTAAGATCACATATGCTGACCTTTATCAGCTTGCTGGAGTTGTTG
CAGTTGAAGTTACTGGGGGTCCAACTGTTGAGTTCATTCCTGGAAGACGTGATTCGTCAG
TTTGCCCCCGTGAAGGGCGTCTTCCTGATGCTAAGAAAGGTGCACTGCACTTGAGGGACA
TCTTTTACCGGATGGGCTTATCAGACAAAGATATAGTAGCTTTATCTGGGGGTCACACTC
TGGGAAGGGCACATCCTGAAAGGTCTGGATTTGAAGGCGCATGGACTCAGGAGCCTCTGA
AGTTTGACAATTCGTACTTTCTTGAGCTACTGAAGGGGGAATCTGAGGGGCTTCTGAAGC
TCCCAACTGACAAGGCATTGTTGGAAGATCCTTCATTTAGACGCTATGTGGATCTTTATG
CCAGGGATGAAGACACCTTCTTCAAGGACTACGCTGAATCGCACAAGAAGCTTTCTGAAC
TTGGCTTCACTCCACGGAGCAGCGGCCCTGCATCTACGAAATCTGATCTTTCAACTGGTG
CTGTACTCGCACAGAGTGCTGTCGGGGTAGCTGTTGCTGCAGCTGTAGTTATCGTGAGCT
ACCTATACGAGGCTTCTAAGAAGAGCAAGTAAGATTGCTATGTTCTTCATCAGCATGGCC
TCATAGTAAGTATCAGGGTCAAATAACAGAATTCTAGTGATGATCCAGCCATACGAACAC
TTCCTTCATGTCTACATATACCCTATCAATATTTCATGGGGAATTATATGGAGATGACAT
AGCTTCACTATTTAAAAGCACTTTGGACATATATTATTCCGTCTTCTGTGTGCTCTCTAA
TATCTACAAGAACAGTGGTTTGTGTCCT

CDS

876 bp

>Os08t0549100-01 Similar to Peroxisome type ascorbate peroxidase.
ATGGCCGCCCCGGTCGTGGACGCCGAGTACCTCCGCCAGGTCGACAGGGCGCGCCGCCAC
CTCCGCGCCCTCATCTCCTCCAAGGGATGCGCGCCCATCATGCTCCGCCTCGCATGGCAT
GACGCGGGCACTTATGACGTGAACACAAAAACTGGTGGTGCAAATGGTTCAATTAGATAC
GAGGAAGAGTACACTCACGGTTCAAATGCTGGTCTAAAGATTGCTATTGATCTTCTCGAG
CCTATTAAAGCCAAGAGCCCTAAGATCACATATGCTGACCTTTATCAGCTTGCTGGAGTT
GTTGCAGTTGAAGTTACTGGGGGTCCAACTGTTGAGTTCATTCCTGGAAGACGTGATTCG
TCAGTTTGCCCCCGTGAAGGGCGTCTTCCTGATGCTAAGAAAGGTGCACTGCACTTGAGG
GACATCTTTTACCGGATGGGCTTATCAGACAAAGATATAGTAGCTTTATCTGGGGGTCAC
ACTCTGGGAAGGGCACATCCTGAAAGGTCTGGATTTGAAGGCGCATGGACTCAGGAGCCT
CTGAAGTTTGACAATTCGTACTTTCTTGAGCTACTGAAGGGGGAATCTGAGGGGCTTCTG
AAGCTCCCAACTGACAAGGCATTGTTGGAAGATCCTTCATTTAGACGCTATGTGGATCTT
TATGCCAGGGATGAAGACACCTTCTTCAAGGACTACGCTGAATCGCACAAGAAGCTTTCT
GAACTTGGCTTCACTCCACGGAGCAGCGGCCCTGCATCTACGAAATCTGATCTTTCAACT
GGTGCTGTACTCGCACAGAGTGCTGTCGGGGTAGCTGTTGCTGCAGCTGTAGTTATCGTG
AGCTACCTATACGAGGCTTCTAAGAAGAGCAAGTAA

Protein

292 aa

>Os08t0549100-01 Similar to Peroxisome type ascorbate peroxidase.
MAAPVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRY
EEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDS
SVCPREGRLPDAKKGALHLRDIFYRMGLSDKDIVALSGGHTLGRAHPERSGFEGAWTQEP
LKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLS
ELGFTPRSSGPASTKSDLSTGAVLAQSAVGVAVAAAVVIVSYLYEASKKSK*

5'UTR

chr08:27559197..27559312 (- strand) : 116 bp

CDS

chr08:27559084..27559196 (- strand) : 113 bp

chr08:27558004..27558128 (- strand) : 125 bp

chr08:27557496..27557545 (- strand) : 50 bp

chr08:27557270..27557335 (- strand) : 66 bp

chr08:27557141..27557189 (- strand) : 49 bp

chr08:27556487..27556569 (- strand) : 83 bp

chr08:27556316..27556395 (- strand) : 80 bp

chr08:27556118..27556220 (- strand) : 103 bp

chr08:27555570..27555776 (- strand) : 207 bp

3'UTR

chr08:27555334..27555569 (- strand) : 236 bp

FASTA

>Os08t0549100-01 class=Sequence position=chr08:27555334..27559312 (- strand)
AGTGAGTACT AGTCACACCA CACGCTTGGC TTGACGCCGC ACGCCTCCGC TCCGCTCCGC CGCCGCGGCC GATCTCTCTA
GGGCTTCCAA CCTCGCCGGC GACGCGACGC CACGCCATGG CCGCCCCGGT CGTGGACGCC GAGTACCTCC GCCAGGTCGA
CAGGGCGCGC CGCCACCTCC GCGCCCTCAT CTCCTCCAAG GGATGCGCGC CCATCATGCT CCGCCTCGCG TACGTACCTA
CCGGCCTACC CCCCATCTCC TGCTCCTCCT AGAACCCTCC CCTAGTTCCT AATCCTTGTG ATGGATTCGC GCGGCGGTGG
CGAGGGAGGG AGCTCTCGTG TGTTTGGATT TGGAGCCCGC TCGGCTCTGC TTGCCTCGAG TGGTGGGATG AGTTACTGCT
GGTGGTGGTG AGATGGGTCG CTTGCGATTG CGAGACTGTA TGATTGGGTT TGGTTAGTTG CTTGCGGCGG GTACCTGCGC
TGGTCCGTGG CGTGGCTGTT GGGCGAGGCA ATTCGACGAA CACCTTGAGT GCGTGCGCGC CTGCTTTGGA TGGCTCCCAG
ATTTGGTTTT GATTGTGTGA CTGCGCCTTT GGAATTAACG AGGAACGGCG GACGATGTTT AGTTCGCTAG TTCACATGTA
GAGTGCACGC GTTTTTCTGT TGATCCGTTG GTTCTCTCAT ACTAGTCAGG AAACTAGCAA CCTAGCAGGG GAGAGCGAGC
ATTTTTAATC ACTCCCCATA TTCCGTCATA ACGGCAATAT CGCAGGAAGC TAAGACGAAT TTCTTATTTC TGTCTATAGT
AGGTGTTCCA CTCCATGAGC TTCGTGTTAC ATTTGTGGAG CTGATGAGAG ACCAGTGTTA CAAACTGGAA CAAATAAGTG
ATGTTTCATT ATCTAAAAAA AGGGGATGTT TGCACTACTG CTGCAAATGT TCTATGTATA TTGTAATTAC GAATGGACTC
AGAAGAAGCA TTACCATTTA ACGCACCATT ACAGATAGTG CAGCGTGTAT TTGCTAATTA ATTAGTACTT TATATATGGA
ATTGTGATTT TTTTTATCTT ATATGTTGTA TACAGTGTTC TTCTGTAATG TACTATGAGT TTTTCTCATT TATCATGGAG
GATATTCTGC GTGCTCTTGG ATTACTCTTG GACTAAAACT TAGTTCCTGT GCACTCCCTT GCAGATGGCA TGACGCGGGC
ACTTATGACG TGAACACAAA AACTGGTGGT GCAAATGGTT CAATTAGATA CGAGGAAGAG TACACTCACG GTTCAAATGC
TGGTCTAAAG ATTGCTATTG ATCTTCTCGG TATGTATTGT TTGTCCCCAA TGTGTTCCTA GATGATTAGA CGAAAGTAGC
TTTCACTTTT CCCCCATTGT CAGAATGGCT CTAGTTCCCT TTAAACCACT CATCAGCTAT ATGATTGATG CCTCTTAAGA
AATCAATTTG AGTTTTCTTG TCAGTTTCTC AAAATTCTTT TCTTTTTCTA TTGTTTTGGG TTTTACCTTG ATCGGACTAC
AAACTAACTC TTTTTTTTCT CTAATTCGGG GATCAAATAT TTTGGGAGAA ATAACTAAAA AACAAGAAAC TCCCATATTT
TTGCAACTAT TCTCAATGGT GTTGCAGTAC TCACCACTCT TCTCTGTACA ATTGCATTAT TTACCTGTTC CACGTTATCT
AGTTTATTGT TATATTGTCA CTTTATTCAG TGATGAAATA AATCGAATGA TTACTTATGC TTCTCCAATT GTCTTTTACT
GTAACAGAGC CTATTAAAGC CAAGAGCCCT AAGATCACAT ATGCTGACCT TTATCAGGTA AATTAGCGTT GCTTGAATTG
GTTCTTGTGC TGCCAACTTA TTATAAGAGT GCCTTGATAC TGTGACATCT TTTTTTTTTC TTGTCGCACA TTTGATCTTT
TTTATCTTAT CGATTACTGT GTAAATTTTT AAGATCCTAA CTAGATTTTT CTTACAGCTT GCTGGAGTTG TTGCAGTTGA
AGTTACTGGG GGTCCAACTG TTGAGTTCAT TCCTGGAAGA CGTGTACGTG AAATAACATT TCTTTATGAA TGGATGCATC
TTTTATTGAT TCACACTTAT TAAGTTCTTT TGACCTGAAT CAGGATTCGT CAGTTTGCCC CCGTGAAGGG CGTCTTCCTG
ATGCTAAGAA AGGTAATTGC CACAAACTAT TCTTTGAACT GGTCTACCTT TTCTTTTGTC ATTATAATCA TGCTTCCTGA
CTCCTAGTGT TTGAAGCAAT GAGTCAAAAT ATGTGTTAGT ATTCTACATG TATCACATTT AGTCCCATGC ATTTCTCCTG
TACTTGTCTG CTAGTACTCA TGTTCTGGCA TTTAGTACTT AGTGTTGCTT GAGACAACCC AGTTCATGCA ATACATACCG
TAATATGTAC ATTATCTTAA ACACACATAC ATCTCTTCAT AGATGGGAGC CTCGTCTTTC ATTTATCTTA TATTCCTGCA
TATCTGGTAT AGTTGTCATT TAGGTGTCAT ACCAGCAGGT GCTGTTGTAT GTCTGGTAAT TTGTTTTATG TTATTTATCT
GTTTTCCTAT TCCTTCTGCC GAAGTCTGTT TTCCTTTCTT ACATTTACTG GGATGCAAGG TGCCAGTTCC TATTTTAGTA
TTTTAATAAC TGGTGCCAGA ATCCTGTTTT GATATGTATA ATCGTAATCA TATATCTATT TTTATGGGGG TATATCTGCA
TTTTATCTTT GTTTCATGAG CAGGTGCACT GCACTTGAGG GACATCTTTT ACCGGATGGG CTTATCAGAC AAAGATATAG
TAGCTTTATC TGGGGGTCAC ACTCTGGTAA ATGCTCTAAT TAATGTAGAA TTTGTGTAAT GGTAATCCTG ATTCTTCATG
AGAAGCACAG TTTTAACAAC TCGCTTTATA CTTCAAGGGA AGGGCACATC CTGAAAGGTC TGGATTTGAA GGCGCATGGA
CTCAGGAGCC TCTGAAGTTT GACAATTCGT ACTTTCTGTA AGTTGAATAC AAAACTGGGT CATTTACGTA CTAATTCTGG
GCACTAGATT TGAGGTTAGA AGATAACAGT GTAATATTTT ATTTAACTGC AGTGAGCTAC TGAAGGGGGA ATCTGAGGGG
CTTCTGAAGC TCCCAACTGA CAAGGCATTG TTGGAAGATC CTTCATTTAG ACGCTATGTG GATCTTTATG CCAGGGTAAA
AAGGATCTTT TATATATATA TTTTTTTTCT ATTCCTTGCA CTTAAAACTC CCCCATTTTA TATGCCCTTT CATCCATTTT
TTAGGACTAT AGGACCATTA ACAAACTATA AAGTATTTGA ATTTGTTAGT TGAAAATGCA ATTAATAGAT TTATTTATTG
TCAAATATGA TTTCGGAGCA TTATATTTTT ACAACTTTTA CTGCTATATA ATTGGAAGTG AATAATTTTC AAAATGCTAC
AAGAACTGTG AATATTTCAT GCCGACGTAC TATGCCTTGC GGTGCTCCAT AATATAAGTT TTACATTCAG AACCATTTCT
TCTGTTCATA TGGCAGGATG AAGACACCTT CTTCAAGGAC TACGCTGAAT CGCACAAGAA GCTTTCTGAA CTTGGCTTCA
CTCCACGGAG CAGCGGCCCT GCATCTACGA AATCTGATCT TTCAACTGGT GCTGTACTCG CACAGAGTGC TGTCGGGGTA
GCTGTTGCTG CAGCTGTAGT TATCGTGAGC TACCTATACG AGGCTTCTAA GAAGAGCAAG TAAGATTGCT ATGTTCTTCA
TCAGCATGGC CTCATAGTAA GTATCAGGGT CAAATAACAG AATTCTAGTG ATGATCCAGC CATACGAACA CTTCCTTCAT
GTCTACATAT ACCCTATCAA TATTTCATGG GGAATTATAT GGAGATGACA TAGCTTCACT ATTTAAAAGC ACTTTGGACA
TATATTATTC CGTCTTCTGT GTGCTCTCTA ATATCTACAA GAACAGTGGT TTGTGTCCT

Locus: Os08g0549100

Loading...

Locus: Os08g0549100

Loading...