Os08t0556900-01

Locus

Os08g0556900

Description

Similar to Cysteine proteinase (EC 3.4.22.-).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CP, OsSAG12-2, SAG12-2

Oryzabase Gene Name Synonym(s)

Cys protease, cysteine protease, senescence-associated gene 12-2

Transcript Evidence

AK072235 (DDBJ, Best hit)

AK099308 (DDBJ, Best hit)

Protein Evidence

B6TYM9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type endopeptidase activity (GO:0004197)

Molecular Function: cysteine-type peptidase activity (GO:0008234)

Functional domain (InterPro)

Peptidase, cysteine peptidase active site (IPR000169)

Peptidase C1A, papain C-terminal (IPR000668)

Peptidase C1A, papain (IPR013128)

Proteinase inhibitor I29, cathepsin propeptide (IPR013201)

Full-length cDNA

J023001J24 (Online Clone Ordering)

J023144C09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0556900-01)

Others

Oryzabase (14983)

Transcript

1436 bp

>Os08t0556900-01 Similar to Cysteine proteinase (EC 3.4.22.-).
ACCACCACCTCACAAGCTAATTCAACCTACTAAGCTAGCTAGCTAGTGACAATTAAGTGA
TCACAAGTGTTGTTGCGATGGGTAGAGTAGTGGTCGTCGTGGCGGCGGCGGCGGTAGCCG
tggccgtcgtcgtgctgctgggcgcggcggcgccggcggcgagcgcgatggagttcggcg
acaaggacgtggcgtcggaggaggcgctgtgggagctgtacgagcggtggcgcgggcagc
accgggtggcgcgggacctcggcgagaaggcgcggcggttcaacgtgttcaaggacaacg
tccgcctcatccacgAGTTCAACcgccgcgacgagccctacaagctccgcctcaaccgct
tcggcgacatgaccgccgacgagttccgccgcgcctacgcctcctcccgcgtctcccacc
accgcatgttccgcggccgcggcgagaggcgcagcggcttcatgtacgccggcgcccgcg
acctgccggcggcggtggactggcgcgagaagggcgccgtcggggcggtcaaggaccagg
gccagtgcggcagctgctgggcgttctcgaccatcgccgccgtggaagggatcaacgcca
tccgcaccagcaacctcaccgcgctgtcggagcagcagctcgtcgactgcgacaccaaga
ccggcaacgccggctgcgacggcggcctcatggacaacgcgttccagtacatcgccaagc
acggcggcgtcgccgcctcctccgcctacccgtaccgcgcccgccagagctcctgcaaga
gctccgcggcgtcgtcccccgccgtcaccatcgacggctacgaggacgtgccggcgaact
cggagtcggcgctgaagaaggcggtggcgaaccagccggtgtcggtggcgatcgaggcgg
ggggctcgcacttccagttctactcggagggggtgttcgccgggaaatgcgggacggagc
tcgaccatggcgtggcggcggtgggctacggcacgacggtggacggcaccaagtactgga
tcgtcaggaactcgtggggcgcagactggggtgagaagggctacatccggatgaagcgcg
acgtgtccgccaaggagggactctgcggcatcGCCATGGAAGCATCCTACCCCATCAAGA
CCTCGCCGAACCCGGCGCCCAAGAAGATCAAGAAGGTCACCGACGACGACGAAGATGATG
ATGACGAGGAGCACCGCCACCACGACGAACTCTAAGCTCATTTAATTGTGTGTTTTACAA
CAGTAACTGGCTACCGTTTGGAGGCGATTGATCGACGTCGTAACAAAATAAGCAGTTCGT
TAATTTAATCACCTGTAGTTGATTTGATTGCATGCTCGTATTTTTTGCAATCTAGCTCGA
TTATGTTTACGCTGTGTAATGATTATTGATTATTAATTTGAAAAAGATTGTTAAGT

CDS

1158 bp

>Os08t0556900-01 Similar to Cysteine proteinase (EC 3.4.22.-).
ATGGGTAGAGTAGTGGTCGTCGTGGCGGCGGCGGCGGTAGCCGtggccgtcgtcgtgctg
ctgggcgcggcggcgccggcggcgagcgcgatggagttcggcgacaaggacgtggcgtcg
gaggaggcgctgtgggagctgtacgagcggtggcgcgggcagcaccgggtggcgcgggac
ctcggcgagaaggcgcggcggttcaacgtgttcaaggacaacgtccgcctcatccacgAG
TTCAACcgccgcgacgagccctacaagctccgcctcaaccgcttcggcgacatgaccgcc
gacgagttccgccgcgcctacgcctcctcccgcgtctcccaccaccgcatgttccgcggc
cgcggcgagaggcgcagcggcttcatgtacgccggcgcccgcgacctgccggcggcggtg
gactggcgcgagaagggcgccgtcggggcggtcaaggaccagggccagtgcggcagctgc
tgggcgttctcgaccatcgccgccgtggaagggatcaacgccatccgcaccagcaacctc
accgcgctgtcggagcagcagctcgtcgactgcgacaccaagaccggcaacgccggctgc
gacggcggcctcatggacaacgcgttccagtacatcgccaagcacggcggcgtcgccgcc
tcctccgcctacccgtaccgcgcccgccagagctcctgcaagagctccgcggcgtcgtcc
cccgccgtcaccatcgacggctacgaggacgtgccggcgaactcggagtcggcgctgaag
aaggcggtggcgaaccagccggtgtcggtggcgatcgaggcggggggctcgcacttccag
ttctactcggagggggtgttcgccgggaaatgcgggacggagctcgaccatggcgtggcg
gcggtgggctacggcacgacggtggacggcaccaagtactggatcgtcaggaactcgtgg
ggcgcagactggggtgagaagggctacatccggatgaagcgcgacgtgtccgccaaggag
ggactctgcggcatcGCCATGGAAGCATCCTACCCCATCAAGACCTCGCCGAACCCGGCG
CCCAAGAAGATCAAGAAGGTCACCGACGACGACGAAGATGATGATGACGAGGAGCACCGC
CACCACGACGAACTCTAA

Protein

386 aa

>Os08t0556900-01 Similar to Cysteine proteinase (EC 3.4.22.-).
MGRVVVVVAAAAVAVAVVVLLGAAAPAASAMEFGDKDVASEEALWELYERWRGQHRVARD
LGEKARRFNVFKDNVRLIHEFNRRDEPYKLRLNRFGDMTADEFRRAYASSRVSHHRMFRG
RGERRSGFMYAGARDLPAAVDWREKGAVGAVKDQGQCGSCWAFSTIAAVEGINAIRTSNL
TALSEQQLVDCDTKTGNAGCDGGLMDNAFQYIAKHGGVAASSAYPYRARQSSCKSSAASS
PAVTIDGYEDVPANSESALKKAVANQPVSVAIEAGGSHFQFYSEGVFAGKCGTELDHGVA
AVGYGTTVDGTKYWIVRNSWGADWGEKGYIRMKRDVSAKEGLCGIAMEASYPIKTSPNPA
PKKIKKVTDDDEDDDDEEHRHHDEL*

5'UTR

chr08:27875142..27875218 (+ strand) : 77 bp

CDS

chr08:27875219..27876376 (+ strand) : 1158 bp

3'UTR

chr08:27876377..27876577 (+ strand) : 201 bp

FASTA

>Os08t0556900-01 class=Sequence position=chr08:27875142..27876577 (+ strand)
ACCACCACCT CACAAGCTAA TTCAACCTAC TAAGCTAGCT AGCTAGTGAC AATTAAGTGA TCACAAGTGT TGTTGCGATG
GGTAGAGTAG TGGTCGTCGT GGCGGCGGCG GCGGTAGCCG tggccgtcgt cgtgctgctg ggcgcggcgg cgccggcggc
gagcgcgatg gagttcggcg acaaggacgt ggcgtcggag gaggcgctgt gggagctgta cgagcggtgg cgcgggcagc
accgggtggc gcgggacctc ggcgagaagg cgcggcggtt caacgtgttc aaggacaacg tccgcctcat ccacgAGTTC
AACcgccgcg acgagcccta caagctccgc ctcaaccgct tcggcgacat gaccgccgac gagttccgcc gcgcctacgc
ctcctcccgc gtctcccacc accgcatgtt ccgcggccgc ggcgagaggc gcagcggctt catgtacgcc ggcgcccgcg
acctgccggc ggcggtggac tggcgcgaga agggcgccgt cggggcggtc aaggaccagg gccagtgcgg cagctgctgg
gcgttctcga ccatcgccgc cgtggaaggg atcaacgcca tccgcaccag caacctcacc gcgctgtcgg agcagcagct
cgtcgactgc gacaccaaga ccggcaacgc cggctgcgac ggcggcctca tggacaacgc gttccagtac atcgccaagc
acggcggcgt cgccgcctcc tccgcctacc cgtaccgcgc ccgccagagc tcctgcaaga gctccgcggc gtcgtccccc
gccgtcacca tcgacggcta cgaggacgtg ccggcgaact cggagtcggc gctgaagaag gcggtggcga accagccggt
gtcggtggcg atcgaggcgg ggggctcgca cttccagttc tactcggagg gggtgttcgc cgggaaatgc gggacggagc
tcgaccatgg cgtggcggcg gtgggctacg gcacgacggt ggacggcacc aagtactgga tcgtcaggaa ctcgtggggc
gcagactggg gtgagaaggg ctacatccgg atgaagcgcg acgtgtccgc caaggaggga ctctgcggca tcGCCATGGA
AGCATCCTAC CCCATCAAGA CCTCGCCGAA CCCGGCGCCC AAGAAGATCA AGAAGGTCAC CGACGACGAC GAAGATGATG
ATGACGAGGA GCACCGCCAC CACGACGAAC TCTAAGCTCA TTTAATTGTG TGTTTTACAA CAGTAACTGG CTACCGTTTG
GAGGCGATTG ATCGACGTCG TAACAAAATA AGCAGTTCGT TAATTTAATC ACCTGTAGTT GATTTGATTG CATGCTCGTA
TTTTTTGCAA TCTAGCTCGA TTATGTTTAC GCTGTGTAAT GATTATTGAT TATTAATTTG AAAAAGATTG TTAAGT

Locus: Os08g0556900

Loading...

Locus: Os08g0556900

Loading...