Os08t0556900-02

Locus

Os08g0556900

Description

Similar to Vignain.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CP, OsSAG12-2, SAG12-2

Oryzabase Gene Name Synonym(s)

Cys protease, cysteine protease, senescence-associated gene 12-2

Transcript Evidence

AK105612 (DDBJ, Best hit)

Protein Evidence

B6TYM9 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: cysteine-type endopeptidase activity (GO:0004197)

Molecular Function: cysteine-type peptidase activity (GO:0008234)

Functional domain (InterPro)

Peptidase, cysteine peptidase active site (IPR000169)

Peptidase C1A, papain C-terminal (IPR000668)

Peptidase C1A, papain (IPR013128)

Proteinase inhibitor I29, cathepsin propeptide (IPR013201)

Full-length cDNA

001-200-B06 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0556900-02)

Others

Oryzabase (14983)

Transcript

1351 bp

>Os08t0556900-02 Similar to Vignain.
AGTAGTGGTCGTCGTGGCGGCGGCGGCGGTAGCCGtggccgtcgtcgtgctgctgggcgc
ggcggcgccggcggcgagcgcgatggagttcggcgacaaggacgtggcgtcggaggaggc
gctgtgggagctgtacgagcggtggcgcgggcagcaccgggtggcgcgggacctcggcga
gaaggcgcggcggttcaacgtgttcaaggacaacgtccgcctcatccacgAGTTCAACcg
ccgcgacgagccctacaagctccgcctcaaccgcttcggcgacatgaccgccgacgagtt
ccgccgcgcctacgcctcctcccgcgtctcccaccaccgcatgttccgcggccgcggcga
gaggcgcagcggcttcatgtacgccggcgcccgcgacctgccggcggcggtggactggcg
cgagaagggcgccgtcggggcggtcaaggaccagggccagtgcggcagctgctgggcgtt
ctcgaccatcgccgccgtggaagggatcaacgccatccgcaccagcaacctcaccgcgct
gtcggagcagcagctcgtcgactgcgacaccaagaccggcaacgccggctgcgacggcgg
cctcatggacaacgcgttccagtacatcgccaagcacggcggcgtcgccgcctcctccgc
ctacccgtaccgcgcccgccagagctcctgcaagagctccgcggcgtcgtcccccgccgt
caccatcgacggctacgaggacgtgccggcgaactcggagtcggcgctgaagaaggcggt
ggcgaaccagccggtgtcggtggcgatcgaggcggggggctcgcacttccagttctactc
ggagggggtgttcgccgggaaatgcgggacggagctcgaccatggcgtggcggcggtggg
ctacggcacgacggtggacggcaccaagtactggatcgtcaggaactcgtggggcgcaga
ctggggtgagaagggctacatccggatgaagcgcgacgtgtccgccaaggagggactctg
cggcatcGCCATGGAAGCATCCTACCCCATCAAGACCTCGCCGAACCCGGCGCCCAAGAA
GATCAAGAAGGTCACCGACGACGACGAAGATGATGATGACGAGGAGCACCGCCACCACGA
CGAACTCTAAGCTCATTTAATTGTGTGTTTTACAACAGTAACTGGCTACCGTTTGGAGGC
GATTGATCGACGTCGTAACAAAATAAGCAGTTCGTTAATTTAATCACCTGTAGTTGATTT
GATTGCATGCTCGTATTTTTTGCAATCTAGCTCGATTATGTTTACGCTGTGTAATGATTA
TTGATTATTAATTTGAAAAAGATTGTTAAGT

CDS

1068 bp

>Os08t0556900-02 Similar to Vignain.
atggagttcggcgacaaggacgtggcgtcggaggaggcgctgtgggagctgtacgagcgg
tggcgcgggcagcaccgggtggcgcgggacctcggcgagaaggcgcggcggttcaacgtg
ttcaaggacaacgtccgcctcatccacgAGTTCAACcgccgcgacgagccctacaagctc
cgcctcaaccgcttcggcgacatgaccgccgacgagttccgccgcgcctacgcctcctcc
cgcgtctcccaccaccgcatgttccgcggccgcggcgagaggcgcagcggcttcatgtac
gccggcgcccgcgacctgccggcggcggtggactggcgcgagaagggcgccgtcggggcg
gtcaaggaccagggccagtgcggcagctgctgggcgttctcgaccatcgccgccgtggaa
gggatcaacgccatccgcaccagcaacctcaccgcgctgtcggagcagcagctcgtcgac
tgcgacaccaagaccggcaacgccggctgcgacggcggcctcatggacaacgcgttccag
tacatcgccaagcacggcggcgtcgccgcctcctccgcctacccgtaccgcgcccgccag
agctcctgcaagagctccgcggcgtcgtcccccgccgtcaccatcgacggctacgaggac
gtgccggcgaactcggagtcggcgctgaagaaggcggtggcgaaccagccggtgtcggtg
gcgatcgaggcggggggctcgcacttccagttctactcggagggggtgttcgccgggaaa
tgcgggacggagctcgaccatggcgtggcggcggtgggctacggcacgacggtggacggc
accaagtactggatcgtcaggaactcgtggggcgcagactggggtgagaagggctacatc
cggatgaagcgcgacgtgtccgccaaggagggactctgcggcatcGCCATGGAAGCATCC
TACCCCATCAAGACCTCGCCGAACCCGGCGCCCAAGAAGATCAAGAAGGTCACCGACGAC
GACGAAGATGATGATGACGAGGAGCACCGCCACCACGACGAACTCTAA

Protein

356 aa

>Os08t0556900-02 Similar to Vignain.
MEFGDKDVASEEALWELYERWRGQHRVARDLGEKARRFNVFKDNVRLIHEFNRRDEPYKL
RLNRFGDMTADEFRRAYASSRVSHHRMFRGRGERRSGFMYAGARDLPAAVDWREKGAVGA
VKDQGQCGSCWAFSTIAAVEGINAIRTSNLTALSEQQLVDCDTKTGNAGCDGGLMDNAFQ
YIAKHGGVAASSAYPYRARQSSCKSSAASSPAVTIDGYEDVPANSESALKKAVANQPVSV
AIEAGGSHFQFYSEGVFAGKCGTELDHGVAAVGYGTTVDGTKYWIVRNSWGADWGEKGYI
RMKRDVSAKEGLCGIAMEASYPIKTSPNPAPKKIKKVTDDDEDDDDEEHRHHDEL*

5'UTR

chr08:27875227..27875308 (+ strand) : 82 bp

CDS

chr08:27875309..27876376 (+ strand) : 1068 bp

3'UTR

chr08:27876377..27876577 (+ strand) : 201 bp

FASTA

>Os08t0556900-02 class=Sequence position=chr08:27875227..27876577 (+ strand)
AGTAGTGGTC GTCGTGGCGG CGGCGGCGGT AGCCGtggcc gtcgtcgtgc tgctgggcgc ggcggcgccg gcggcgagcg
cgatggagtt cggcgacaag gacgtggcgt cggaggaggc gctgtgggag ctgtacgagc ggtggcgcgg gcagcaccgg
gtggcgcggg acctcggcga gaaggcgcgg cggttcaacg tgttcaagga caacgtccgc ctcatccacg AGTTCAACcg
ccgcgacgag ccctacaagc tccgcctcaa ccgcttcggc gacatgaccg ccgacgagtt ccgccgcgcc tacgcctcct
cccgcgtctc ccaccaccgc atgttccgcg gccgcggcga gaggcgcagc ggcttcatgt acgccggcgc ccgcgacctg
ccggcggcgg tggactggcg cgagaagggc gccgtcgggg cggtcaagga ccagggccag tgcggcagct gctgggcgtt
ctcgaccatc gccgccgtgg aagggatcaa cgccatccgc accagcaacc tcaccgcgct gtcggagcag cagctcgtcg
actgcgacac caagaccggc aacgccggct gcgacggcgg cctcatggac aacgcgttcc agtacatcgc caagcacggc
ggcgtcgccg cctcctccgc ctacccgtac cgcgcccgcc agagctcctg caagagctcc gcggcgtcgt cccccgccgt
caccatcgac ggctacgagg acgtgccggc gaactcggag tcggcgctga agaaggcggt ggcgaaccag ccggtgtcgg
tggcgatcga ggcggggggc tcgcacttcc agttctactc ggagggggtg ttcgccggga aatgcgggac ggagctcgac
catggcgtgg cggcggtggg ctacggcacg acggtggacg gcaccaagta ctggatcgtc aggaactcgt ggggcgcaga
ctggggtgag aagggctaca tccggatgaa gcgcgacgtg tccgccaagg agggactctg cggcatcGCC ATGGAAGCAT
CCTACCCCAT CAAGACCTCG CCGAACCCGG CGCCCAAGAA GATCAAGAAG GTCACCGACG ACGACGAAGA TGATGATGAC
GAGGAGCACC GCCACCACGA CGAACTCTAA GCTCATTTAA TTGTGTGTTT TACAACAGTA ACTGGCTACC GTTTGGAGGC
GATTGATCGA CGTCGTAACA AAATAAGCAG TTCGTTAATT TAATCACCTG TAGTTGATTT GATTGCATGC TCGTATTTTT
TGCAATCTAG CTCGATTATG TTTACGCTGT GTAATGATTA TTGATTATTA ATTTGAAAAA GATTGTTAAG T

Locus: Os08g0556900

Loading...

Locus: Os08g0556900

Loading...